KEGG   Ketogulonicigenium vulgare Y25: EIO_2854Help
Entry
EIO_2854          CDS       T01338                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EIO_2854
Enzymes [BR:kvu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     EIO_2854
    3.5.1.-  
     EIO_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2760648..2761268
Genome map
AA seq 206 aa AA seqDB search
MQTRDPFPENEALIVIDVQNDFCPGGALAVAGGDQIVAGINDLMAQFQTVVLTQDWHPAG
HSSFASSHAGQSPYSVIDMPYGPQVLWPDHCVQGTGGADFHPALNVHAAHLVIRKGFRPG
IDSYSAFFENDHSTVTGLDGYLRARGITRVTLVGLATDFCVNYSAVDAARLGYAVSVDTG
LSRGIDLNGSLADALETMAEAGVVIK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgcgcgatccctttccggaaaatgaggctctgatcgtcatcgacgtgcagaat
gatttctgtccaggcggtgccttggccgtggcgggcggggatcagatcgtcgccggcatc
aatgatctgatggcgcagttccagaccgtggtgctgacgcaggattggcaccccgcaggt
cattccagctttgccagcagccatgcaggccagagcccctatagcgtgatcgacatgccc
tatggcccgcaggtgctgtggcccgatcactgcgtccaaggcacaggcggcgcggatttc
caccccgcgctgaatgtgcatgcggcgcatctggtgatccgcaaaggcttccgccccggc
atcgacagctattcggctttctttgaaaacgaccacagcacggtgacaggccttgatggc
tacttgcgcgcgcgcggcatcacgcgcgtgacgctggtcggcctcgccacggatttttgc
gtgaattattctgcggtggatgcggcgcgccttggctatgcggtgagtgtcgacaccggc
ctctcgcgcgggatcgacctgaacggctcgctggccgatgcgctggaaaccatggccgag
gctggcgtcgttatcaagtaa

DBGET integrated database retrieval system