KEGG   Ketogulonicigenium vulgare Y25: EIO_2929Help
Entry
EIO_2929          CDS       T01338                                 

Definition
(GenBank) putative PAS/PAC sensor protein
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu02020  Two-component system
kvu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EIO_2929
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    EIO_2929
Enzymes [BR:kvu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     EIO_2929
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     EIO_2929
Two-component system [BR:kvu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   EIO_2929
Bacterial motility proteins [BR:kvu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    EIO_2929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheB_methylest PAS_10 HWE_HK PAS_4 CheR_N PAS_9 IncA Sec8_exocyst PAS HisKA_2 DegS CENP-F_leu_zip Snapin_Pallidin DUF1664 Spc7 DUF812 Exonuc_VII_L COG5 GAS DUF4795 Fez1 Med30 APG6 HOOK DUF3450 TSNAXIP1_N PilJ Sec20 AAA_13 HATPase_c_2 Laminin_II HMMR_N CheZ DUF745 HAUS-augmin3 Mnd1 Ribosomal_S7e TBPIP UPF0184 DUF2203 Fmp27_WPPW Golgin_A5 FapA TPR_MLP1_2 IFT57 Seryl_tRNA_N Flagellin_N zf-C4H2 Baculo_PEP_C TMPIT DUF4407 V_ATPase_I NPV_P10 HemX ATG16 Mod_r Rootletin LMBR1 CCDC144C AAA_23 HIP1_clath_bdg
Motif
Other DBs
NCBI-ProteinID: ADO43998
UniProt: E3F4V4
Position
pYP1:complement(62606..65728)
Genome map
AA seq 1040 aa AA seqDB search
MLRLSDRFPIVSIGCAQSALPALETFFETLEPNPGFAIVIVMHLEELRDSDVCDAIAGWT
GMPVAVAAADTPVASNTVYIMPADAILTIEDGVLRSNAPDMAKRERKPVDVFFADLAQDQ
REYAVGVILSGGNADGTLGAKAIREAGGLTLAQSLDDDEALNPDMPQSAISINIIDLAIP
VEEIPDRLRIFARSFDTLEAVSRASDELTRTDLQRAHREICAILAGHSTHDFSGYKTKTF
FRRVRRRMQVQQSETLDNYIDLLRKDPTEVTNLFRDLLINVTSFFRDEDAFKLLEKEIIP
KLFEHKKSSDTLRIWVPGCATGEEVYSIAILMREFIERHPNAPRVQIFATDIDEAALSVA
RAGRYPEALLDGLSAERRRRYVRPDGASFVIINEVREMCVFSPHSLVRDPPFSRMDMVSC
RNLLIYFGPEVQRDVIPVFHYSLRPRGYLFLGSSESIGKHSHLFSTLDKKHRIFQARDHS
PKALRLTSNVSHNRSFLFTDASASSQKERDTSLRSKVESRILERFAPAHVVVNSDADIVY
YSAGTSPFLEAPQGVPSRQLMTLARKGLRLDLRAALSECVSTQKRVTRQNLLAERESDEV
QIVDFTIEPISDRAGAEQLYLVVFEAKSPPSAQALGGQYSLSDDRHTELEHELRDTKERL
QSTIEEYETALEELKSSNEELVSVNEEVQSSNEELEASKEEMQSLNEELNTINSELNGKI
EELDRANNDLRNLFESTRIATIFLDRGLVIRTFTPEAAQFFNLRTNDVGRPLTELSSQLD
YPSLSEDIRAVFASGDALDHHVAKDRDGQQYLVRVIPYRTDGNEIDGVIVTFVDVTQLAE
AEHMQHVLVEELNHRVKNLLLVVGSIAKRTIEKSQSVSTFERAFSGRLAALSRAYGSLSR
DQWVDSSIADIFTAELAPFGHSAFHIEGPDLSLPVQIGLSLTMVAHELTTNAAKYGALSV
DAGLVKVQWQFENSQLTIDWSETGGPGAKEPSENGFGFELLEGEISYRLSGEIKKVYEKT
GFRATITIPLSPYATEKSKF
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttgtctgacaggtttcctatcgtctcaatcggttgcgcccaaagcgccctt
cccgcgctcgagacatttttcgagacgctcgagccgaacccggggttcgccatcgttatt
gtgatgcacctagaggagcttcgcgacagcgatgtttgcgacgccatcgcaggctggacc
ggtatgcccgtcgctgtcgcagccgcagatacgcctgttgcgtctaacaccgtttacatc
atgcccgcggatgcaatcctgacgatcgaggatggcgtgctgcggtcaaacgcgccggac
atggccaagcgcgagcgtaagcccgtggatgtgttctttgccgaccttgcccaagatcag
cgcgaatatgccgttggggtcatactttcgggcggaaacgcagacggaaccttgggcgcc
aaggccattcgcgaagcgggcggtctgacgcttgcccaatcccttgatgatgacgaagcg
ctcaaccctgacatgccgcaaagcgctatcagcatcaacatcatcgaccttgccatccct
gtcgaagaaatccccgaccgccttcggatttttgcacgcagctttgacacgctggaggcc
gtaagccgcgcaagcgacgagttgacccggacggatctgcagcgtgcgcatcgtgaaatc
tgcgccatacttgcaggccactcgacccatgacttttcaggctacaaaaccaagacgttt
ttccggcgtgttcgcagacggatgcaggttcagcaaagcgagacactggacaattatatt
gatttgttgcgcaaggacccgacagaggtaacgaacctttttcgtgatcttctgatcaac
gtcacgagcttttttcgggacgaagacgcgttcaagttactggaaaaagagattattccg
aaacttttcgaacataaaaagtcttctgataccctgcgcatttgggtgcccggatgtgca
acgggcgaagaggtctattccattgcaatcttgatgcgcgaattcattgagcggcatccg
aatgccccgcgcgtgcagatatttgcgaccgacatcgacgaggctgcactctctgttgcg
cgcgccgggcgctatccagaggcattgctcgacggcctgtcggcggagcgtcgtcggcgc
tatgtgcgccccgatggcgcgagctttgtgatcatcaacgaagtgcgcgagatgtgtgtt
ttctcgccccatagtctggtgcgcgacccgccgttttcgcgcatggatatggtgtcgtgc
cgtaatctactgatctattttggccccgaggtgcagcgcgatgtgatcccggtgtttcac
tattctttgcgcccgcgtgggtatctgtttcttggcagctcggaaagtattggcaaacat
agccatctttttagcacgctcgataaaaagcaccgtattttccaggcccgcgaccattcg
ccaaaagcgctgcgactgacgtcgaatgtcagccacaatcggtctttccttttcacggat
gccagcgcgagctcgcaaaaggagcgggacacctcgctgcgaagcaaagtggaatcccgc
attctggaacggtttgcccccgcgcatgttgtggtgaactctgatgcggatatcgtttat
tattctgcgggaacctcgccctttctagaagcgccccaaggcgttccgagccgtcaattg
atgaccctcgcacgaaaggggctacgtctggatctgcgcgctgcgctaagtgaatgcgtt
tcaacgcaaaaaagggtgacgcgccaaaatctgctggccgaacgcgaaagcgatgaggtg
caaatcgtagatttcaccatcgagccaatcagcgatcgggccggtgcggaacagctctat
cttgttgtgttcgaggcgaagtccccgccatccgcacaggcactgggtggccagtacagc
ctgtcggacgaccggcacacagagcttgaacacgagttgcgggataccaaagaacggctt
caatcaacgattgaagaatacgaaacagcgcttgaagagcttaaatcctcgaatgaggag
cttgtttctgtgaatgaagaagtccaatcaagtaacgaagagctggaggcatccaaagag
gagatgcagtcgctcaacgaagaattaaataccataaattccgaattgaacggaaagatt
gaggagctagatcgcgccaataatgatttgcgcaatctttttgaaagcacccgcattgca
acgatcttcttggatcgtggacttgttattcgtacctttacacctgaagccgcccaattc
ttcaatctgcgcacgaatgatgtcggtcgccccctgacagaactgtccagccaactcgat
tatcccagcctgagcgaagatataagagccgttttcgcctcgggcgatgctttggatcat
catgtcgcaaaagaccgcgacgggcagcaatatcttgtgcgcgttatcccataccgcacc
gacgggaacgaaatagatggtgtgatcgtcacttttgtagatgttacacaattggccgaa
gccgagcatatgcagcatgttctggtggaggaactcaaccatcgtgttaaaaacctgctc
ctcgtcgtgggatctattgccaagcgcacgattgaaaagtctcaatccgtttcaacattt
gagcgcgcgtttagtggacgattggcggccttaagccgcgcatatggatctctctcgcgg
gatcaatgggtcgattcctcgatcgctgacatattcactgcggaacttgcgccgtttggg
catagtgcttttcacattgagggccccgatttatcgctgccggtgcaaatcggtctttca
ctcaccatggtcgcccacgagttaacaacgaatgcggccaaatatggcgcgctttcggtc
gatgcgggtctggtgaaagtgcaatggcagttcgagaacagccaacttacgattgattgg
tcggaaacgggtgggccgggcgcgaaagagccgtctgaaaacggctttggattcgaattg
ctagagggcgaaatatcttatcgcctcagcggtgagatcaagaaggtttatgaaaagacc
ggatttcgtgcgacgatcacgatccccctgtcgccctatgccactgaaaagtctaaattt
tag

DBGET integrated database retrieval system