KEGG   Candidatus Liberibacter asiaticus gxpsy: WSI_00255Help
Entry
WSI_00255         CDS       T02506                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
laa  Candidatus Liberibacter asiaticus gxpsy
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WSI_00255
   00330 Arginine and proline metabolism
    WSI_00255
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    WSI_00255
Enzymes [BR:laa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     WSI_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(58232..59167)
Genome map
AA seq 311 aa AA seqDB search
MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFS
IQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVS
DAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIR
YKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCG
HYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIR
TGWSIFDPSVI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ttggatttaaaaaaaattatagatggtatttatgaagagataaagccccaaattggtcaa
ggtcgtgtagcagattatattcccgaattggctaaggtgcgtattgatcattttggtatg
tctcttgctttagaagatggcactgtctattccgtaggtgaatcggaatttttgttttca
attcaaagtatttcgaaggtttttcttctcacgatagctctacgaaagtttgatgaggaa
atttggaaacgcgttggtcgggaaccttcaggatcttcttttgattcaatagtacagctt
gagaatgagaatggtattccccgcaatccgtttgttaatgctggagctatagttgtctcg
gatgcagttcttgggagcagttctgcagatgatgcaatagagaattttttgaattttatg
cgtggtattgccggtgatgcatcaattcatattgattccgttgttgctaattcagaaatt
gaaacgggttaccgtaattttgctcttgcgaattttgtacgttcttatggtaacataagg
tataaaattgaggatgttttgaaattttattttcatcaatgttccctcatgatgaattgc
gtgcaacttgccaagtcgggtttgtatcttgcatttcgaggatataattccttaacgaat
cagtcggttatctctccactacagtcccgttgcgtgaacgcagtaatgctgacatgtggt
cattatgatcattctggtgattttgcatatcgtgttggatttcctggtaaaagtggtgtt
ggaggaggtattctagctattgtgccgtctaaagcgtccattgctgtttggtctcctggt
ttggataattctggcaattccttattgggtgctaaagcgcttgaacttttagcaattcgc
acaggttggtcaatatttgatccttcggtgatctaa

DBGET integrated database retrieval system