KEGG   Candidatus Liberibacter asiaticus gxpsy: WSI_03745Help
Entry
WSI_03745         CDS       T02506                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
laa  Candidatus Liberibacter asiaticus gxpsy
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WSI_03745
Enzymes [BR:laa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     WSI_03745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
845995..846582
Genome map
AA seq 195 aa AA seqDB search
MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR
FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR
RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD
KGKTDFFLKMTHNQR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaaaagccgaccgttgaggaagccaaagaagcgataagggttattttacgt
tggattggtgatgatccagatcgtgaggggcttaaagatacgcctgatcgtgttataaag
tcgtataaagagctttttgcaggttataaacagatccctaccactcaggatacatcacgt
tttcattttggggaagcatccaagtatcaagatatggttttaataaaagatatatctttt
ttttcgtattgtgagcaccatattttgcctatttgggggaaaatccatcttgcatatatc
cctaaaaaacatgtgattggcttgtcaaaattggttcgtattttagaagtttattcacgt
cgtttgcagatacaagagcggttgacgatgcagatcgcccatgcaatagagagtagtact
gattctaagggagtagctgttttaattgaaggacagcatatgtgtatgtctatgagagga
attaaacgggatggtttaactacagtgactacggcttttacaggtgagtttagtagagat
aagggaaaaacggattttttccttaaaatgacccataatcaacggtag

DBGET integrated database retrieval system