KEGG   Lactobacillus acidophilus NCFM: LBA0185Help
Entry
LBA0185           CDS       T00231                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBA0185 (gpmA)
   01230 Biosynthesis of amino acids
    LBA0185 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBA0185 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LBA0185 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBA0185 (gpmA)
Enzymes [BR:lac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBA0185 (gpmA)
Exosome [BR:lac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBA0185 (gpmA)
  Exosomal proteins of melanoma cells
   LBA0185 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
178485..179177
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKATAEKYGDEQVHIWRRSYDVL
PPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVTLDRVMPFWEDNIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMDLEMKTGEPVVYTFDENLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattagttttaatccgtcacggtcaaagtgaatggaacctttcaaaccaattt
actggttgggttgacgttaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaatcaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcattggaagaaagtgaccaactttggattccagaaact
aagacttggagacttaacgaacgtcactacggtgctcttcaaggcttgaacaagaaggct
actgctgaaaagtacggtgatgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgacgatgacaacgaatttagtcaagcacatgaccgtcgttacgcaaac
ttggatccacacatcgttcctaaggcagaaaacttacacgtaactttggatcgtgtaatg
ccattctgggaagataacattgctccagacttacttgacggtaagaacgtaattattgct
gcacacggtaactcacttcgtgctttgactaagtacattgaaaacatttctgacgatgac
atcatggacctcgaaatgaagactggtgaaccagttgtttacactttcgacgaaaacttg
gatgttgttaacaaggaaaagttggacgactaa

DBGET integrated database retrieval system