KEGG   Lactobacillus acidophilus NCFM: LBA0185Help
Entry
LBA0185           CDS       T00231                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac00010  Glycolysis / Gluconeogenesis
lac00260  Glycine, serine and threonine metabolism
lac00680  Methane metabolism
lac01100  Metabolic pathways
lac01110  Biosynthesis of secondary metabolites
lac01120  Microbial metabolism in diverse environments
lac01130  Biosynthesis of antibiotics
lac01200  Carbon metabolism
lac01230  Biosynthesis of amino acids
Module
lac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lac_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBA0185 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LBA0185 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBA0185 (gpmA)
Enzymes [BR:lac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBA0185 (gpmA)
Membrane trafficking [BR:lac04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LBA0185 (gpmA)
Exosome [BR:lac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBA0185 (gpmA)
  Exosomal proteins of melanoma cells
   LBA0185 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-GeneID: 3252143
NCBI-ProteinID: YP_193112
UniProt: Q5FMJ3
Position
178485..179177
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKATAEKYGDEQVHIWRRSYDVL
PPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVTLDRVMPFWEDNIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMDLEMKTGEPVVYTFDENLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattagttttaatccgtcacggtcaaagtgaatggaacctttcaaaccaattt
actggttgggttgacgttaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaatcaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcattggaagaaagtgaccaactttggattccagaaact
aagacttggagacttaacgaacgtcactacggtgctcttcaaggcttgaacaagaaggct
actgctgaaaagtacggtgatgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgacgatgacaacgaatttagtcaagcacatgaccgtcgttacgcaaac
ttggatccacacatcgttcctaaggcagaaaacttacacgtaactttggatcgtgtaatg
ccattctgggaagataacattgctccagacttacttgacggtaagaacgtaattattgct
gcacacggtaactcacttcgtgctttgactaagtacattgaaaacatttctgacgatgac
atcatggacctcgaaatgaagactggtgaaccagttgtttacactttcgacgaaaacttg
gatgttgttaacaaggaaaagttggacgactaa

DBGET integrated database retrieval system