KEGG   Lactobacillus acidophilus NCFM: LBA0379Help
Entry
LBA0379           CDS       T00231                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBA0379 (recR)
DNA repair and recombination proteins [BR:lac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     LBA0379 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LBA0379 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5
Motif
Other DBs
NCBI-GeneID: 3253016
NCBI-ProteinID: YP_193301
UniProt: Q5FM04
Position
355138..355737
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIAHLIDAYMKLPGIGEKTATRLAFYTMDMPQEDVEDFSKALIQVKQDIHQCPIC
GNITEKEICDICSNPNRDQTTIMVVEQPKDLMALEEMGEYDGLYHVLHGVLSPMDGIGPE
EVNIKSLITRLQKNDDVKEVILALNSTPEGESTSMYISKLIKPAGIKVTRLAAGLSVGSD
IEYANSITLKRAVQGRTTL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatatccattaccaattgctcatttaattgatgcttatatgaagcttccaggaatt
ggagaaaaaacggctacccgcttagctttttatacaatggatatgccacaagaggatgtt
gaagacttttctaaagctttaattcaagtaaaacaagatattcatcaatgtccaatttgt
ggcaatatcactgaaaaagaaatatgtgatatttgttcaaatcctaatcgtgatcaaaca
actatcatggttgtcgaacagcctaaagacttaatggcacttgaagaaatgggcgaatat
gatggactttatcatgtgcttcatggtgtactttcaccaatggatggaattgggccagaa
gaagttaatatcaaatctttaattactcgtttacaaaaaaatgatgatgttaaagaagtg
attttggcgcttaattctactccagaaggtgaatcgacgtctatgtatattagtaagttg
attaaaccagctggaattaaagtgactcgtctagccgcaggactttctgtcggaagcgac
atagaatatgctaattcaattacattgaagcgagcagtacaaggaagaacaacattataa

DBGET integrated database retrieval system