KEGG   Lactobacillus acidophilus NCFM: LBA0410Help
Entry
LBA0410           CDS       T00231                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBA0410 (ruvA)
Enzymes [BR:lac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LBA0410 (ruvA)
DNA repair and recombination proteins [BR:lac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LBA0410 (ruvA)
    RecFOR pathway proteins
     LBA0410 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
385952..386539
Genome map
AA seq 195 aa AA seqDB search
MYEYFEGIISEVTPSYVVVDVNGIGYKVFSPTPFAYKQGQKAKVYIEQIVRDTGITLYGF
QDQDDKGLFLKLLSVSGIGPKSAMAIMAAEDSNSLAEAIEQGEVKYLTRFPGVGKKTASQ
IVLDLKGKLGDYVARLDKPENGEEISPALNDALLALIALGYTQKEVDRITPKLVEIEADT
ADQYIKKGLALLLKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatactttgaaggcataatttctgaagttacgccaagctatgttgtagtagac
gttaatggaattgggtacaaggtttttagtccaacaccttttgcttataaacaaggacaa
aaagccaaggtatatatcgaacaaattgttcgtgatactggcattactttatatggattt
caagatcaagatgataaaggattatttcttaaattgcttagtgtaagtgggatcggtcct
aagagtgcaatggcaattatggctgctgaagatagtaattcacttgctgaagctattgaa
caaggtgaagttaaatatttaacacgttttcctggtgtgggtaaaaagaccgcttcacaa
attgttttggatttaaaaggtaagctaggagattatgtggctcgccttgataagccggaa
aacggagaggaaatttctcctgctttaaatgatgcattattggctttaattgccttgggc
tatactcaaaaagaagtagatcgtattacaccaaagcttgtagaaattgaggcagatact
gcagatcaatatattaaaaaaggcttagcgttactgcttaagaagtag

DBGET integrated database retrieval system