KEGG   Lactobacillus acidophilus NCFM: LBA0410Help
Entry
LBA0410           CDS       T00231                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBA0410 (ruvA)
Enzymes [BR:lac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LBA0410 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385952..386539
Genome map
AA seq 195 aa AA seqDB search
MYEYFEGIISEVTPSYVVVDVNGIGYKVFSPTPFAYKQGQKAKVYIEQIVRDTGITLYGF
QDQDDKGLFLKLLSVSGIGPKSAMAIMAAEDSNSLAEAIEQGEVKYLTRFPGVGKKTASQ
IVLDLKGKLGDYVARLDKPENGEEISPALNDALLALIALGYTQKEVDRITPKLVEIEADT
ADQYIKKGLALLLKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatactttgaaggcataatttctgaagttacgccaagctatgttgtagtagac
gttaatggaattgggtacaaggtttttagtccaacaccttttgcttataaacaaggacaa
aaagccaaggtatatatcgaacaaattgttcgtgatactggcattactttatatggattt
caagatcaagatgataaaggattatttcttaaattgcttagtgtaagtgggatcggtcct
aagagtgcaatggcaattatggctgctgaagatagtaattcacttgctgaagctattgaa
caaggtgaagttaaatatttaacacgttttcctggtgtgggtaaaaagaccgcttcacaa
attgttttggatttaaaaggtaagctaggagattatgtggctcgccttgataagccggaa
aacggagaggaaatttctcctgctttaaatgatgcattattggctttaattgccttgggc
tatactcaaaaagaagtagatcgtattacaccaaagcttgtagaaattgaggcagatact
gcagatcaatatattaaaaaaggcttagcgttactgcttaagaagtag

DBGET integrated database retrieval system