KEGG   Lactobacillus acidophilus NCFM: LBA0461Help
Entry
LBA0461           CDS       T00231                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LBA0461 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBA0461 (adhE)
   00620 Pyruvate metabolism
    LBA0461 (adhE)
   00650 Butanoate metabolism
    LBA0461 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LBA0461 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LBA0461 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBA0461 (adhE)
   00626 Naphthalene degradation
    LBA0461 (adhE)
Enzymes [BR:lac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LBA0461 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LBA0461 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
445913..448543
Genome map
AA seq 876 aa AA seqDB search
MAKAQQKETPTEEEKKKQIYDMVDNLVKRSHVALDEMANFTQEQVDKICEAVATAGEQNA
YPLAKMAVEETKRGVVEDKTTKNMYASENIWNSLRHEKTVGVIEEDKELGLTKIAEPKGV
IAGVTPVTNPTSTVIFKAMLALKTRNTIIFGFHPQAQKCCVETGKIIQAAAVAAGAPKDA
ILWIEEPSLDATTDLMNNPGVQTILATGGPGMVKAAYSSGKPAIGVGPGNGPSYIEKSAN
IGRAVYDIVLSKNFDNGMVCASENSVVVDDAIYDKAVEEFKKWGCYFLNKEEIKKFEEHF
IDPRRGTVAGPVAGKSAYEIAKLCGVDVPKTTKVIVAEYKGVGRKFPLSAEKLSPVFTLY
RAKNHDDAFKICSELLDYGGRGHTAGIHSSDQNIIDEFAMKMDACRILVNSPAALGGIGD
LYNNMLPSLTLGTGSYGANTFSHNIGARDLLNIKTVAKRRDNMQWVKVPSKTYFEHNAAN
YLRHMPNVNRFFIVTDEGVADQGFADEITDIISKRRGQKEYEVFKAVTLDPDTDVIKDGV
HRMNIFKPDVIIAIGGGSVMDAAKVMRLFYENPEMSFEEAYQKFLDIRKRVVRFPKINGV
QLVCIPTTSGTGSEVSPIAVISDTKTGMKHTLCDYALTPDVSIVDDQFVQNMPKRLIAWS
GFEALGHAIESYVSTMATDFTRGWSLEAIKAIFANLKKSYDGDLDARKQMHDAATIAGMA
YSNAFLGLEHSIAHTVGSTFDIPSGVSDAIALPQVIRFNAKRPEKLAMWPHYSVYRAESD
YADIARAIGLTGSSDAELVEKLVQKIIELAHSVGIKMAYKDYGVDKTEFDKKVDQMAVEA
YGDQNTVTNPSAPLITQIVVLMKDCYEGKGISDNDK
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcacaacaaaaagaaactcctactgaggaagaaaagaaaaagcaaatctac
gacatggtagataatttagtaaaaagatcacatgttgcattagatgaaatggctaacttc
acacaagaacaagttgataagatctgtgaagcagttgctactgcaggtgaacaaaacgct
tacccactagctaaaatggctgttgaagaaactaagcgtggtgtagtagaagataagact
actaaaaacatgtacgctagtgaaaatatttggaacagtttacgccacgaaaaaactgtt
ggtgtaattgaagaagataaggaactaggattaactaagattgctgaacctaagggtgtt
attgccggtgttactccagtaactaacccaacttcaactgttattttcaaagcaatgctt
gctctaaagacgagaaatactattatttttggtttccacccacaagctcaaaaatgttgt
gtagaaactggtaaaattatccaagcggctgctgttgctgcaggtgcacctaaagatgca
attttatggattgaagagccaagtttggatgcaaccactgatttaatgaataatccaggt
gttcaaactattttggccactggtggtccaggtatggttaaggctgcatattcatcaggt
aaaccagctatcggtgttggtcctggtaatggtccttcatacattgaaaaatcagctaat
atcggtcgtgctgtttatgatattgttttatcaaagaacttcgataacggtatggtttgt
gcttctgaaaactcagtcgttgtagatgacgcaatttatgacaaggctgtagaagaattt
aagaagtggggttgttacttcttaaataaagaagaaattaagaaatttgaagaacacttt
attgatccaagacgtggtactgttgcaggtcctgtagctggtaaatcagcttatgaaatt
gctaaactttgtggtgttgatgtaccaaagactactaaagtaattgttgctgaatacaaa
ggtgttggtagaaagttcccactttcagctgaaaaactttctcctgtctttactttatat
cgcgctaagaatcatgacgatgcatttaagatttgttctgaacttcttgattatggtggt
cgtggtcataccgcgggaattcactcaagcgatcaaaatataattgatgaatttgcaatg
aagatggatgcttgtcgtattctagttaattcaccagctgcacttggtggtattggtgat
ctttacaacaatatgttgccttcacttacattaggtacaggttcatacggtgctaacaca
ttttcacacaatattggtgccagagatttacttaatattaaaacggttgcgaaacgtcgc
gacaatatgcaatgggtaaaagttccatcaaagacttactttgaacataatgctgctaat
tatttgcgtcacatgccaaatgttaaccgtttcttcattgttactgatgaaggcgtagct
gaccaaggctttgctgacgaaatcactgatattatttctaagcgtcgtggtcaaaaagaa
tatgaagtatttaaggctgtaacgcttgatcctgatactgatgtaattaaagacggtgtt
cacagaatgaacatctttaagcctgacgtaattattgctattggtggtggctcagtaatg
gatgctgctaaagtaatgcgcttattctacgaaaatccagaaatgagctttgaagaagct
taccaaaagtttttggatatcagaaaaagagtagtccgcttccctaagattaatggtgtt
caacttgtatgtattccaacaacttctggtactggttcagaagtttccccaattgcagtt
attagcgatactaaaacaggtatgaaacacactctttgtgattatgctttaactccagat
gtttcaattgttgatgatcaatttgttcaaaatatgcctaaacgcttaattgcttggtca
ggttttgaagcattaggtcatgctattgaaagctatgtttcaactatggccactgatttc
actcgtggttggtcacttgaagctattaaagcgatctttgcaaacttgaagaagtcatac
gatggtgatcttgatgcaagaaagcaaatgcatgatgctgcaactattgcaggtatggca
tattcaaatgcattccttggtcttgaacactcaattgctcatactgttggctcaaccttt
gatattccaagcggagtaagtgatgcgattgctttaccgcaagttattcgctttaatgcc
aaacgtcctgaaaagctcgctatgtggcctcactactcagtatatcgtgctgaaagtgac
tatgctgatattgcaagagctatcggtttgactggttcaagtgatgctgaattagttgaa
aaactggttcaaaagattattgaattggctcattctgttggtattaagatggcttataag
gattatggcgttgacaagactgaatttgataagaaagttgatcaaatggcagttgaagct
tatggtgatcaaaatactgtaactaatccatcagcaccacttattacacaaattgttgtc
ttaatgaaagattgctacgaaggcaaaggtatttcagacaatgataaataa

DBGET integrated database retrieval system