KEGG   Lactobacillus acidophilus NCFM: LBA0587Help
Entry
LBA0587           CDS       T00231                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBA0587 (rbsK)
Enzymes [BR:lac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LBA0587 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
572309..573232
Genome map
AA seq 307 aa AA seqDB search
MKKIVVIGSSNVDTTLHVKDFPKPGETINATEITTAAGGKGANQAIAAAKSGAETYFINR
VGEDSEGGYITHQLKSYGVDTTYVQTTMGVKTGHAYITLNEAGQNNIVIDHGANYELTVE
DIKAAGDLIKSWDCIIAQFETPIEVTTAAFKMAKKAGKITILNPAPAVEEIPEELLKYTD
IITPNETESAKITGIQIKDKSSLAANAEKLHLLGVKNVVITYGDKGSYISTKDIETLIPA
YKVEATDTTGAGDTFIGYLASNLNEDLSNFEDAAKIASRASSIAVQRLGAQPSIPTAQEV
EQAMEDE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgttgttattggttcaagcaatgtagatactacattgcatgtaaaggat
tttccaaaacctggtgaaactatcaacgctacagaaattactactgcagctggtggtaag
ggagccaatcaggctattgctgctgctaaaagtggcgcagagacttattttattaatcgt
gtgggagaagatagtgaaggcggctatattactcatcaattaaagagttatggtgtagat
actacttatgttcaaactacgatgggtgttaagacagggcatgcgtatattacattaaat
gaagcgggtcaaaataatattgttatcgaccatggtgcaaattatgaattaactgttgaa
gatattaaagcagcaggtgatttgattaagagctgggactgtattatcgcccaatttgaa
acaccaattgaagtaactacagctgcctttaagatggccaaaaaggctggtaaaattact
attttaaacccagctcctgcagttgaagaaattccagaagaattattgaagtatacagat
atcattacaccaaatgaaactgaaagtgctaagattacaggaattcaaattaaagataag
tcatctttggctgcgaatgctgaaaagttgcatttacttggtgtaaagaacgttgtaata
acttatggtgataagggatcatatatttctactaaagacattgaaactttaatccctgca
tataaggttgaagcaactgatactactggtgcaggcgatacctttattgggtatttggca
agtaacttaaatgaagatttatctaactttgaagatgctgccaaaattgccagtcgtgct
tcatcaattgctgtacaacgtttaggtgcccaaccatcaattcctactgctcaagaagtc
gagcaagcaatggaggacgaataa

DBGET integrated database retrieval system