KEGG   Lactobacillus acidophilus NCFM: LBA0600Help
Entry
LBA0600           CDS       T00231                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBA0600
Enzymes [BR:lac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LBA0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
585252..587651
Genome map
AA seq 799 aa AA seqDB search
MTVNYDSKDYLKSVDAYWRAANYLSVGQLFLMKNPLLKKPLTAEDVKPKPIGHWGTIAPQ
NFIYAHLNRALKKYDLDMFYIEGSGHGGQVMVSNSYLDGSYTERYPEITQDEKGMAKLFK
RFSFPGGVASHAAPETPGSIHEGGELGYALSHGVGAILDNPDVIAAVEIGDGEAETGPLA
ASWFSDKFINPIKDGAVLPILQINGFKISNPTIVSRMSDEELTEYFRGMGWDPHFVSVFK
GGRFDGEKDPMQVHEEMAKTMDEVIEEIKAIQKHARENNDATLPHWPLIIFQCPKGWTGP
KKDLDGNPIENSFRAHQIPIPVSQYDMKHVDMLTDWLESYKPNELFNEDGSPKEIVTENT
AKGDQRMAMNPITNGGKDPKRLNLPDYRNFALKFDKPGSVEAQDMVEWAKYLNEVAKLNP
TTFRGFGPDESKSNRLFKLLDDQKRQWEPEVHEPNDENLAPSGRVIDSQLSEHQDEGFLE
GYVLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKEQYWRHDYPSLNFVATSTVFQQDH
NGYTHQDPGILTHLYEKNRPDLVHEYLPSDTNTLLAVGNKAFTDRECINVLVTSKQPRPQ
WFSIEEAQKLVDKGLSYIDWASTDKGVKPDIVFASTETEPTIETLAAIDILHDKFPDLKI
RYINVIDVMKLMSPKDNKNGISDEEFDRLFPKDVPVIFAWHGYKSMMESIWFARNRHNVH
IHCYEENGDITTPFDMRVLNHLDRFDLAKDAVESVDKLKGKNADFISHMDDLLEKHHQYI
RDNGKDMPEVTEWKWKGLK
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgacagttaattacgattccaaagattacttaaagagcgttgacgcatattggcgtgca
gctaattatttgtcagttggacaattatttttaatgaaaaatccgttgttaaagaaacct
ttaacagctgaagatgtaaaacctaagccaatcggtcactggggtactattgctccacaa
aactttatttatgctcacttaaatcgtgcgcttaaaaaatatgacttggatatgttctat
attgaaggttcaggtcacggtggccaagtgatggtttcaaattcatatcttgatggttca
tatactgaacgttatccagaaattacccaagatgaaaagggtatggctaaattgtttaag
cgctttagtttcccaggtggtgtagcttctcacgctgctcctgaaactccaggttctatt
catgaaggtggggaattaggatacgcactttcacatggggtaggtgctattttagacaat
ccagatgtaattgctgccgttgaaattggtgatggtgaagcagaaactggtccacttgca
gctagctggttcagtgacaagtttattaatccaattaaggatggtgcagttttaccaatt
cttcaaattaatggtttcaagatttctaacccaactatcgtttcaagaatgagcgatgaa
gaattaactgaatacttccgtggcatgggttgggatccgcactttgtttcagtatttaag
ggtggccgctttgacggtgaaaaggatccaatgcaagtccacgaagaaatggctaaaacc
atggacgaagtaattgaagaaattaaggctattcaaaagcatgctcgtgaaaataatgat
gctactttgccacattggccattgattatcttccaatgtccaaagggctggaccggtcca
aagaaggatcttgacggcaatccaattgaaaactcatttagagcacaccaaattccaatt
cctgtctcacaatacgatatgaaacatgttgatatgttgactgattggcttgaaagttat
aagccaaacgaattattcaacgaagatggttcaccaaaggaaattgttactgaaaacact
gctaagggtgatcaacgtatggcaatgaatccgatcactaatggtggtaaggatcctaaa
cgattgaacctaccagattatcgcaactttgcacttaagtttgacaagccaggttcagtt
gaagcacaagacatggttgaatgggctaaatatttaaacgaagttgctaaacttaaccca
actactttccgtggctttggtcctgatgaatctaaatcaaaccgtttatttaaactttta
gatgatcaaaagcgtcaatgggaacctgaagttcatgaaccaaatgatgaaaacttggca
ccaagtggccgcgttatcgattcacaattatcagaacaccaagacgaaggcttccttgaa
ggctacgttttaactggtcgtcacggcttctttgcaacctacgaagcatttggtcgtgta
gtagattcgatgcttactcaacatatgaagtggcttagaaaagctaaagaacaatattgg
cgtcatgattatccatcacttaactttgttgctacttcaacagtattccaacaagatcac
aatggttacactcaccaagatccaggcattttaactcacttatatgaaaagaatcgtcca
gatttagttcatgaatacttgccatcagatactaatactttacttgctgtaggtaacaag
gcatttactgatcgtgaatgtattaatgttttagtaacttcaaagcaacctcgtccacaa
tggttctcaattgaggaagcacaaaagttagttgataaaggtttaagttacattgattgg
gcttcaactgataaaggtgtaaaaccagatattgtctttgcttcaacagaaactgaacca
acaattgaaactttggcagcaattgatattttgcatgacaagttcccagatcttaagatt
cgctacattaacgtaattgatgtgatgaaattaatgtcaccaaaggacaataagaatggt
atttctgatgaagaatttgatcgcttattcccaaaggacgttcctgtaatctttgcatgg
cacggctacaagagtatgatggaatcaatttggtttgcacgtaaccgtcataatgtacat
attcactgctacgaagaaaacggtgatattactaccccatttgatatgcgtgttttgaac
caccttgacagatttgatcttgccaaagatgctgttgaaagtgttgataaattgaagggc
aagaacgctgactttatcagtcatatggatgacttgcttgaaaagcaccaccaatacatt
cgtgataatggtaaagatatgccagaagttactgaatggaagtggaagggcttgaagtaa

DBGET integrated database retrieval system