KEGG   Lactobacillus acidophilus NCFM: LBA0625Help
Entry
LBA0625           CDS       T00231                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBA0625
   00052 Galactose metabolism
    LBA0625
   00500 Starch and sucrose metabolism
    LBA0625
   00520 Amino sugar and nucleotide sugar metabolism
    LBA0625
Enzymes [BR:lac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBA0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
611205..612107
Genome map
AA seq 300 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKKSGIEDILIIIGKNK
RPIEDHFDANPELEQDLKEKGKDELLELTQGITNLGVNLYYTRQPHPAGLGDAIYRARSF
VGDEPFVVMLGDDLMDDKVPLTKQLIDRYNKTHASTIAVMPVPHEEVSKYGVIEPENEIL
PGLINVKSFVEKPDVDKAPSDYAIIGRYLLMPEIFEILANQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFKGERHDVGNKEGYLETSIEYGLKHPEIKDQLREYIQRLGKKFEAEDKRKNK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagctattattcctgcagctgggttaggtactagattcttacctgca
actaaagctttgccaaaagaaatgttaccaattgttgataagccaacaattcaatttatt
gttgaagaagctaaaaaatctggaattgaagatatcctgattattattggtaaaaataag
cgcccaattgaagaccattttgatgcaaatcctgaactagaacaggatttgaaggaaaaa
gggaaagatgaacttcttgaattaactcagggaattactaatttgggtgttaacttatat
tacactagacaacctcatccagcaggccttggagatgcaatttatcgtgcccgtagtttt
gttggagatgaaccttttgtagttatgcttggtgatgatttgatggacgacaaagttcca
ttaactaagcaattaattgatcgatacaacaagactcatgcctcaactattgctgttatg
ccagtaccacatgaagaagtatcaaaatatggtgttatcgaaccagaaaatgaaatttta
cctggtttaattaacgttaagtcatttgtcgaaaaaccagatgttgacaaggcaccaagt
gactatgcaattattggccgctatttgttaatgcctgaaatttttgaaattttagcaaat
caaaaaccaggtcgtggtggagaaatccaattaactgatgccattgatacaatgaataag
actcaacgtgtatttgcccatgtctttaagggtgaacgtcatgatgttggtaacaaagaa
ggatatcttgaaacttcaattgaatatggtttaaagcatccagaaattaaagatcaattg
cgtgaatatattcaacgcttaggcaaaaaatttgaagctgaagataagcgaaaaaataaa
taa

DBGET integrated database retrieval system