KEGG   Lactobacillus acidophilus NCFM: LBA0626Help
Entry
LBA0626           CDS       T00231                                 

Gene name
thil
Definition
(RefSeq) acetyl-CoA C-acetyltransferase thil
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBA0626 (thil)
   00630 Glyoxylate and dicarboxylate metabolism
    LBA0626 (thil)
   00640 Propanoate metabolism
    LBA0626 (thil)
   00650 Butanoate metabolism
    LBA0626 (thil)
  Lipid metabolism
   00071 Fatty acid degradation
    LBA0626 (thil)
   00072 Synthesis and degradation of ketone bodies
    LBA0626 (thil)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBA0626 (thil)
   00310 Lysine degradation
    LBA0626 (thil)
   00380 Tryptophan metabolism
    LBA0626 (thil)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBA0626 (thil)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBA0626 (thil)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LBA0626 (thil)
Enzymes [BR:lac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBA0626 (thil)
Exosome [BR:lac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBA0626 (thil)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
612217..613374
Genome map
AA seq 385 aa AA seqDB search
MKDIYIVAAKRTPFGKYRGFFKDASAVDMGVMALKGTLKASGINPEDVQALFMGNVLETG
LGENMARQVALYSGMKESSAAVTINEVCGSSLKAVRLAQGQMEMGDLDLVAVGGSESMTR
APYFINKEDKDNPEKMTSTMLNDGLMDAFSGKHMGITAENVAEKYNVSREEMDKFSLASH
QKAAKATEAGLLKNEILDVEIDGQVLDHDEPIRPGTSLEALGNLKPVFKEDGQVTAGNAS
PLTDGASMVILATKEKMEELDLTPVAKLGDFAEAGFDPAYMGYTPYFAVKKLLAKTGRSI
NDYDLIELNEAFAAQSIPVARDLEIPMDKLNIMGGAISLGHPLGATGTRLISTAVNGLKN
NDGKLALVTLCIGGGQAIAYEIENV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatttatattgtcgctgctaaaagaaccccttttggcaaataccgtggtttt
tttaaagacgcttctgcagttgatatgggagtaatggcacttaaaggaactttaaaagca
agtggaattaatcctgaagatgtgcaagctttatttatgggaaatgttttagaaacagga
cttggtgaaaatatggctcgtcaagttgctctttattcgggaatgaaggaaagctctgct
gcagttacaattaatgaagtttgtggatcgagtttaaaggccgtccgactcgcacaaggt
caaatggagatgggagatcttgatttagtagccgttggtggaagcgagagtatgactcgt
gcaccatattttatcaataaagaagataaagataatccagagaagatgaccagtacaatg
cttaatgacggtctaatggatgctttttcaggtaagcacatgggaattactgcagaaaat
gttgcagaaaaatataatgtttcgcgtgaagaaatggataaatttagtttagcatcacat
caaaaggctgctaaagctactgaagctggtttgttaaaaaatgaaattttggatgttgag
attgatggtcaagtattggatcacgatgaaccaattcgtccaggcactagcttagaagca
ttgggtaatttgaagccagtatttaaagaagatggtcaagtaacagccggaaatgcttca
cctcttactgacggtgccagcatggtgattttggctactaaagaaaagatggaagaatta
gatttaactcctgttgctaaattaggtgattttgcggaagccggttttgatcctgcatat
atgggatataccccttactttgctgtaaagaagctattagccaaaactggtcgttcaatt
aatgactatgatctaattgaattaaatgaagcttttgcagcacaaagtattccagttgca
cgagacttagaaattccgatggataagttaaatatcatgggaggagcaatttctcttggt
cacccattaggtgcgacgggtactcgtttgattagtacagcagttaatggattgaaaaat
aatgatggcaagttggctttagtcactctatgtattggtggtggtcaagcaattgcttat
gaaatcgagaacgtgtaa

DBGET integrated database retrieval system