KEGG   Lactobacillus acidophilus NCFM: LBA0700Help
Entry
LBA0700           CDS       T00231                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBA0700 (tpiA)
   01230 Biosynthesis of amino acids
    LBA0700 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBA0700 (tpiA)
   00051 Fructose and mannose metabolism
    LBA0700 (tpiA)
   00562 Inositol phosphate metabolism
    LBA0700 (tpiA)
Enzymes [BR:lac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LBA0700 (tpiA)
Exosome [BR:lac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LBA0700 (tpiA)
  Exosomal proteins of bladder cancer cells
   LBA0700 (tpiA)
  Exosomal proteins of melanoma cells
   LBA0700 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
695315..696073
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLHMNPEQTTEFVDAVKGKLPDPSKVESLICAPAVDLDALRKAAEGSNL
HIGAENCYFEDEGAYTGETSPKVLKEMGIDYVIIGHSERRGYFHETDEDINKKAKAIFAN
GMKPIICCGESLETREANKQEDWVVAQIKAALDGLTAEQVSSLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLD
PESFLALVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtacaccaattattgctggtaactggaaattacacatgaacccagaacaaact
actgagtttgttgacgctgttaagggtaagttgccagatccaagtaaggttgaatcactt
atttgtgcacctgcagttgaccttgacgctttgagaaaagcagctgaaggttcaaactta
catatcggtgcagaaaactgctactttgaagatgaaggtgcctacactggtgaaacttca
cctaaggtccttaaagaaatgggtattgactacgtaattattggtcactcagaacgtcgt
ggttacttccacgaaactgatgaagatattaacaagaaagctaaggctatttttgctaat
ggtatgaagccaattatttgctgtggtgaatcacttgaaactcgtgaagctaacaagcaa
gaagattgggtagttgcccaaattaaggctgctttagacggacttactgctgaacaagta
tcttcacttgtaattgcttatgaaccaatctgggctattggtactggtaagactgcttca
tcagatcaagcagaagaaatgtgcaagactattcgtgaaactgttaaggacttgtacaac
gaagaaactgcagaaaatgttcgtattcaatacggtggttctgtaaagccagctaacgtt
aaggaattaatgtcaaaacctgatattgatggtggattagttggtggtgcttcacttgat
cctgaatcattcttagctttggtaaactaccaagactaa

DBGET integrated database retrieval system