KEGG   Lactobacillus acidophilus NCFM: LBA0825Help
Entry
LBA0825           CDS       T00231                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBA0825
Enzymes [BR:lac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LBA0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
806021..808375
Genome map
AA seq 784 aa AA seqDB search
MVEFTGRINGIVFENDKDLYKILDVEIIGSLENYSRDEIKVIGNFGDIQIGSSYRFDGKL
VMHEKFGLQFRASSYKQVLPHEEGSLTKYLSSDKFPGIGKKAANTIIDELGLNALDILKE
SPAKIDTLSLTSKQKDSLLSGLNTMDSYSEIVLKLAKYGINKRVAGKVYQLYHGDSLAKL
EKDPYVAVNEVAGFGFKTADTLGKQLDIRLDDPRRIKGAIYQVLLDALNGEGNTYVTLAD
LLTQANELLQIEQFDPIANCINELQEQGKVVVSGDTAALQNIFQTEIDIARSMKNLVQNQ
ALQENESYDDAEIEAAIEDAEDKLKIKYDGTQKLAIKNALKNPISILTGGPGTGKTTIIN
GILLALRKLAEIPAAALYSDNPPFLLAAPTGRAAKRMGEITEISAKTIHRMLGLGIGDID
TSELNELNGEILIIDEMSMVDMFLFRQLLSSINQVKHIVFVGDKDQLPSVGAGNVFSDLI
KSGAFPTAILKQIHRQGDDSTIIALAHDVNEGKDEQALFKKTKNYSFISCRPELVGDAVG
QIVELALKRGFAKDDIQVLGAMYHGNGGVNNLNDIIQDIMNPPKAKSKSIEVHNEIFRIG
DRILQLQNNPEKDIYNGQIGKIISIDENNSQKCMVANFDDREITFSKKDMNDITRAYAIT
IHKSQGSEFPLVVLNLTMQNFVMLKRNLLYTAITRAEKNLVLVGDSRAFLAAFKTAGNDR
KTGLSEKICEQLDIKTKNTSDEDEKVKEKESTEVKKESEDYILTPDKIYSGEIDPMIGMI
DIKL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaatttaccggtagaattaacgggatcgttttcgaaaacgacaaagatttatat
aaaattttagatgtagaaattattggttcgcttgaaaattattcacgtgatgaaataaag
gtaatcggtaattttggtgatattcaaattggaagtagttatcgctttgatggtaagctg
gttatgcatgaaaagtttggcctacaattcagggccagcagttataagcaagtcttacca
catgaggaaggctctttaacaaagtatttaagctctgataaatttccaggtattggtaaa
aaagcagctaatactattatcgatgaattaggattaaatgctttagacattttaaaagaa
agcccagctaaaatagataccctgtctttaacaagtaagcaaaaagatagtttattatct
ggactgaatacaatggattcatattcggaaatagtattaaaactagctaagtatgggatt
aataaacgagttgcaggtaaagtgtaccagctctatcatggcgatagtttagctaaacta
gaaaaagatccctatgtggcagttaatgaagttgcaggttttggttttaaaacagctgat
actttaggtaaacagttagatatcagactggatgatcctcgaagaataaaaggggctatt
tatcaagtattgctagatgcattgaatggtgaaggaaatacttatgtaactttagcagat
ttattaacgcaggctaatgaattactacagattgaacaatttgatccgattgctaactgt
ataaatgaattgcaagaacagggaaaagttgttgtcagtggagatactgctgctttacaa
aatatctttcagactgaaatagatattgctcgttcaatgaaaaatttggttcaaaaccaa
gctttgcaagaaaatgaaagttatgatgatgcagaaattgaagcagcgattgaagatgct
gaagataaactaaaaattaaatatgatggtacacaaaaattagcaattaagaatgctctt
aagaatcctatttcaattttgacaggtggacctgggaccggtaaaactactattattaat
gggattttgttagcattaagaaaattggctgaaatacctgctgctgcattgtatagtgat
aatccaccattcttattggctgcccctacgggaagagctgccaaaagaatgggtgagatt
actgaaattagtgctaagacaattcaccggatgttgggtttaggtattggtgatatagat
actagtgaattaaatgaattgaatggtgaaattttaattattgatgaaatgtcaatggtt
gatatgttcttgtttagacaattattatctagcattaatcaggtgaaacatattgtcttt
gtaggtgataaagatcaattaccatctgttggagcagggaatgtttttagtgatttaatt
aaatcaggtgcgtttcctactgctattttgaaacaaattcatagacaaggcgatgattca
actattattgctttagcccatgatgttaatgaaggtaaggacgagcaggctctatttaaa
aaaacaaaaaattattcattcattagctgccgccctgaactggtgggggatgcagtaggt
caaatcgtagaattagcattaaaacgtggatttgctaaagatgacattcaagttttagga
gcaatgtatcatggaaatggtggagtaaacaatttaaacgatattattcaagatattatg
aatccaccaaaagctaagagtaaatctattgaagtccataatgaaatttttagaattgga
gatagaattttacagttacaaaataatccggaaaaagacatttataacggtcaaatcggt
aaaattatcagtattgatgaaaataattcccaaaaatgtatggtagctaattttgatgat
cgtgaaataacttttagtaaaaaagatatgaatgacataactagagcatatgcaattact
attcataaatctcagggctcagagttcccattggttgttttaaatttgaccatgcaaaat
ttcgttatgcttaaacgtaatcttttgtatacagcaattacacgtgctgaaaaaaatcta
gtacttgttggcgattcccgtgcttttttagctgcttttaaaacagcaggaaatgatcga
aagactggtttatcggaaaaaatttgtgagcaacttgatattaaaacaaaaaatactagt
gatgaagatgaaaaagtaaaagaaaaagaaagtactgaagtgaaaaaagaaagtgaagat
tatattttaacgcctgataagatatattctggtgagatcgatccaatgattggtatgata
gatattaagttgtaa

DBGET integrated database retrieval system