KEGG   Lactobacillus acidophilus NCFM: LBA0881Help
Entry
LBA0881           CDS       T00231                                 

Definition
phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lac00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(858384..859865)
Genome map
AA seq 493 aa AA seqDB search
MSFTNKFTWGGATAANQYEGGYNEGGKGLNAVDVLTNGSATEPRKVTWKKSNGETGATPL
VWGQDFKLPDGAVPTLLDGYYYPSHQGTDFYHHYKEDIKLMSEMGFDVFRLSMNWSRILP
NGDDKKANEEGLEFYDKVFDECAKYGIEPLVTLSHYETPLSLITRFGGWKDRHLIDAFVH
YADIVMNHYKGKVRYWLTFNEINAMDMAPYMGGGLIDGSEQNRAQGAHNQFVASAKVVKL
AHEIDTNNRVGQMLAYSAYYPYTCDPKDQLKVMEVKQDMLFYSDVQTGGRYPDYRLKKYE
RDGIKLNDNPEDYELIAKYPADFLSFSCYTSNVLTTHEADAKASGNVTAGGVKNPYLESN
AWGWATDPDVLRIALNDLWDRYHKPLWVVENGLGSADTLEKDGSVHDDYRINYLRSQIKS
MRDAVTLDGVDLMGYTTWSAIDLVSNGTGEMKKRYGFVYVDRDDRGNGTLKRYPKDSFYW
YKKVIDSNGEDLD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcactaataaatttacttggggcggtgctaccgctgctaatcaatatgaaggc
ggatataacgaaggcggaaaaggcttaaacgctgttgatgttttaacaaatggttctgca
accgaaccacgcaaagtaacctggaaaaagtcaaatggtgaaacaggggctacaccatta
gtatggggacaagatttcaaacttccagatggtgcagtccctactctcctagatggttat
tattatccaagtcatcaaggaacagacttttatcaccactacaaagaagacattaaatta
atgtctgaaatgggttttgatgtcttcagattatcaatgaattggtcaagaattttacca
aatggtgatgacaagaaagccaacgaagaaggcttagaattttacgataaagtatttgac
gaatgtgctaagtacggtattgaaccattagtcactttatctcactatgaaactcccctc
tcattaattacccgctttggcggctggaaagatcgtcatttgattgatgcatttgttcac
tacgctgatatcgttatgaaccattataaaggtaaggttagatattggcttacttttaac
gaaatcaatgctatggatatggcaccatacatgggtggtggcctaattgatggtagtgaa
caaaatcgtgctcaaggtgcacataatcaatttgttgctagtgctaaagtagtaaaatta
gctcatgaaattgacactaataatcgtgtaggtcaaatgcttgcttactcagcttactat
ccatatacttgtgatcctaaagatcagcttaaagttatggaagttaaacaagacatgctc
ttctatagcgacgttcaaactggtggacgttatcctgactatcgcctcaagaagtatgaa
cgagatggtattaaattgaacgataacccagaagattatgaattaattgccaaatatccc
gctgatttcttgagtttttcatgctatacttcaaatgttttaactactcatgaggctgat
gctaaagcttctggtaatgttactgctggtggtgttaaaaacccatatcttgagagtaat
gcatggggatgggcaactgacccggatgtattgagaatcgctctaaacgatttatgggac
cgctatcataaacctttatgggtagttgaaaatggtttaggctctgcagatactcttgaa
aaagatggttcagtacatgatgattatcgtattaactacttacgtagccaaattaaatca
atgcgtgatgctgtaactcttgatggtgttgatttaatgggttatactacctggtctgca
atcgatcttgtttcaaatggtacaggtgaaatgaagaaacgctacggttttgtctatgta
gatcgagacgatcgtggtaatggaacacttaaacgttatcctaaggattcattttattgg
tacaagaaagttatagattctaatggtgaagatttagattag

DBGET integrated database retrieval system