KEGG   Lactobacillus acidophilus NCFM: LBA0886Help
Entry
LBA0886           CDS       T00231                                 

Definition
(RefSeq) sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac00010  Glycolysis / Gluconeogenesis
lac00052  Galactose metabolism
lac00500  Starch and sucrose metabolism
lac00520  Amino sugar and nucleotide sugar metabolism
lac00521  Streptomycin biosynthesis
lac01100  Metabolic pathways
lac01110  Biosynthesis of secondary metabolites
lac01120  Microbial metabolism in diverse environments
lac01130  Biosynthesis of antibiotics
lac01200  Carbon metabolism
Module
lac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lac_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBA0886
   00052 Galactose metabolism
    LBA0886
   00500 Starch and sucrose metabolism
    LBA0886
   00520 Amino sugar and nucleotide sugar metabolism
    LBA0886
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LBA0886
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LBA0886
Enzymes [BR:lac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LBA0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG AnmK FtsA Pan_kinase Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 3251799
NCBI-ProteinID: YP_193776
UniProt: Q5FKM9
Position
complement(864028..864912)
Genome map
AA seq 294 aa AA seqDB search
MLRRIFTMNLAAIDIGGTTIKIATWKDGKLQDKHAIDTPENLDSFYQVLTNEVNKIKKNT
PIEGVAISSPGAVNKKTGIIGGSSAIPYIHNFKIVDELEKCFGLPVSIENDANSAALGEL
AEGSGKGCNSMAFFIIGTGIGGALIMDQKIWHGAHLFGGEFGYMIMGTHTLSELASPVAM
ANRYNKRTGKKLDGKTVFELADQDDPVASDVRQTLIHALAVAIYNIQHSFDPEKIVIGGG
ISNNPKLVSLLNKEIDRLRDDLDLVTLKPDIVLCTLKSDANLRGAVADFEQNHK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaggagaatttttactatgaatttagcagcaattgatattggtggtactactatt
aaaatcgcaacttggaaagatggaaagttacaagacaaacatgctatcgatactcctgaa
aatttagacagtttttatcaggtcttgactaatgaagtaaataaaattaaaaaaaatact
cctattgaaggggtagcaatttcctcacctggcgcagtaaataaaaaaactgggattatt
ggtggatcaagtgccattccatacatccataattttaaaatagttgatgaattagaaaaa
tgctttggcttgcctgtttcaattgaaaacgacgctaactctgccgctcttggtgaacta
gctgaaggtagcggtaaaggctgtaatagtatggctttctttattattggcactggtatt
ggtggcgctttaatcatggatcaaaaaatttggcatggagctcacttatttggtggtgaa
ttcggttatatgattatgggaacacatactttaagtgagttagcttctcctgttgcaatg
gcaaatcgctataataagcgaacgggtaaaaagttagacggaaaaaccgtttttgaactt
gctgatcaagatgaccctgtagctagtgatgtacgtcaaactttaattcatgctttagct
gtagcaatttataatattcagcacagttttgatccagaaaaaattgttatcgggggcggt
atttctaataatcctaaattagtctctttattaaataaagaaattgatcgtttaagagat
gatttggatttagtaaccttgaaaccagatattgttttatgcactttaaagagcgatgca
aatcttaggggtgcagttgcggatttcgaacaaaatcataaataa

DBGET integrated database retrieval system