KEGG   Lactobacillus acidophilus NCFM: LBA0902Help
Entry
LBA0902           CDS       T00231                                 

Gene name
dfrA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LBA0902 (dfrA)
   00670 One carbon pool by folate
    LBA0902 (dfrA)
Enzymes [BR:lac01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LBA0902 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
876715..877218
Genome map
AA seq 167 aa AA seqDB search
MIEYVWAEDKEKNIGLNGHLPWYLPADMKHFKEVTINHPIIMGRKTFESFPNLLPKRKHI
VLTHNEELKNKYQNNDQVTILPTVEDLHNFVAEHQDERMCAIGGVSIFNALMDQVEVLEK
TEIDAIFEADTKMPEIDYSRFNLVAKKHYEPDEKNKYPYTFLTYKLK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatatgtttgggcagaagataaagaaaaaaatattggcttgaatggacattta
ccatggtatttgccggctgatatgaagcattttaaagaagtaacaattaatcatccaata
attatgggaagaaaaacatttgaaagttttcctaatttgttacctaaaagaaaacatatt
gttttaactcataatgaagagctaaaaaataaatatcaaaataatgatcaagtgactatt
ttacccacagttgaagatttacataattttgtggcagaacatcaagatgagcggatgtgt
gcaattggtggagtgtcgatttttaacgctttaatggaccaagtagaagtattagaaaaa
acggagatagatgcgatttttgaagcagatactaaaatgcctgaaattgattatagccgt
tttaatttagtagctaagaagcattatgagccggatgagaaaaataagtatccatatact
tttttaacttataaattaaagtaa

DBGET integrated database retrieval system