KEGG   Lactobacillus acidophilus NCFM: LBA1022Help
Entry
LBA1022           CDS       T00231                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac00220  Arginine biosynthesis
lac00330  Arginine and proline metabolism
lac01100  Metabolic pathways
lac01110  Biosynthesis of secondary metabolites
lac01130  Biosynthesis of antibiotics
lac01230  Biosynthesis of amino acids
Module
lac_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    LBA1022
   00330 Arginine and proline metabolism
    LBA1022
Enzymes [BR:lac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     LBA1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 3252387
NCBI-ProteinID: YP_193902
UniProt: Q5FKA3
Position
1014416..1015279
Genome map
AA seq 287 aa AA seqDB search
MIEKTIRLVVPDWQAGDNPVYKLGAKVLKAIAPENKEQKTITVKTADSNQTLEKENNVTA
QSAVLKNIRNTKKVIITEQPNKIITFGGNCLVSQQPIDYLNGIYGEKLGVIWIDAHPDIS
NPEVFYNEHAMVVGNLLHRGDPAIQKEVDNPLKSNQIFYAGLQEPTNNEKKLIEQAGIKY
KVQDENQIDSERVIDWIKENNFEHIYIHLDVDVMNSDSKNFYATYFNNPDLGEIPDNAAV
GKMSRKSIWQFISNFSQEYNLVGLTLAEYLPWSAKEMLDLMNNTNIF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaaaacaattcgattagttgttccagattggcaagcaggtgataatcccgtc
tataaattaggagcaaaagttttaaaagcaatagcaccggagaataaagaacaaaagaca
attacggtaaaaactgctgatagtaaccaaacgttagagaaagaaaataacgtaacagct
caatcagctgtattaaaaaatattagaaatactaaaaaagtcatcattaccgaacaacca
aataaaattattaccttcggtggtaattgtttagtatcgcagcaaccaattgactatctt
aacggaatctatggagaaaaattaggtgttatctggattgatgcacatcctgatatttct
aatccggaagttttttataatgaacacgctatggtagtgggaaatctattacatcgtggt
gatccagctattcaaaaagaggtagataatccgttaaaatctaatcaaattttctacgct
ggtttacaagagccgactaacaatgaaaagaaattaattgaacaagcaggtatcaaatat
aaggttcaagatgaaaatcaaatagattctgaaagagtaatagattggatcaaagaaaat
aattttgaacatatttatattcacttagatgtggatgtaatgaactctgattcaaagaat
ttctatgccacatattttaacaatcctgatctaggagaaatacctgacaatgcagcagta
ggtaaaatgagtagaaagagcatctggcaatttattagtaacttcagccaagaatataat
cttgttggtctaaccttagctgagtatttgccttggagtgctaaagaaatgttagattta
atgaataatactaatattttttag

DBGET integrated database retrieval system