KEGG   Lactobacillus acidophilus NCFM: LBA1114Help
Entry
LBA1114           CDS       T00231                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac00010  Glycolysis / Gluconeogenesis
lac00071  Fatty acid degradation
lac00350  Tyrosine metabolism
lac00625  Chloroalkane and chloroalkene degradation
lac00626  Naphthalene degradation
lac01100  Metabolic pathways
lac01110  Biosynthesis of secondary metabolites
lac01120  Microbial metabolism in diverse environments
lac01130  Biosynthesis of antibiotics
lac01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBA1114
  Lipid metabolism
   00071 Fatty acid degradation
    LBA1114
  Amino acid metabolism
   00350 Tyrosine metabolism
    LBA1114
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBA1114
   00626 Naphthalene degradation
    LBA1114
Enzymes [BR:lac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LBA1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 3252844
NCBI-ProteinID: YP_193989
UniProt: Q5FK16
Position
1090774..1091223
Genome map
AA seq 149 aa AA seqDB search
MSHHEDRAKLGREFGATDIVSERGDEAIEKVLELTNGVGVDAVQECVGAVRAIEQAGKIA
RPGVVIGRVGVPQTEPSSNTLFWKNTGLRGGIANVTTYDKSIFVKAVLEGDINPSKVFTK
RFDLDHIQEAYEAMDKREAIKSLIIVADK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaccatgaggatcgtgcaaaattaggtcgcgaatttggtgcaactgatattgtt
tctgaacgtggcgacgaagcaattgaaaaagttttggaattaactaacggtgtaggtgtt
gatgcagttcaagaatgtgtaggtgcggttagggctattgaacaggctggtaagattgct
cgtccgggcgtggtaattggtcgtgtgggtgttcctcaaacagaaccatcgtcaaatact
ttattctggaagaatactggtcttcgcggtggtattgctaatgttactacctatgacaag
agcatttttgtaaaggctgttcttgaaggtgatattaacccaagcaaggtatttactaaa
cgttttgacttagatcacattcaagaagcatatgaagctatggataaacgtgaagctatt
aagtcactaatcattgttgctgataagtaa

DBGET integrated database retrieval system