KEGG   Lactobacillus acidophilus NCFM: LBA1114Help
Entry
LBA1114           CDS       T00231                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LBA1114
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBA1114
  Lipid metabolism
   00071 Fatty acid degradation
    LBA1114
  Amino acid metabolism
   00350 Tyrosine metabolism
    LBA1114
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBA1114
   00626 Naphthalene degradation
    LBA1114
Enzymes [BR:lac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LBA1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1090774..1091223
Genome map
AA seq 149 aa AA seqDB search
MSHHEDRAKLGREFGATDIVSERGDEAIEKVLELTNGVGVDAVQECVGAVRAIEQAGKIA
RPGVVIGRVGVPQTEPSSNTLFWKNTGLRGGIANVTTYDKSIFVKAVLEGDINPSKVFTK
RFDLDHIQEAYEAMDKREAIKSLIIVADK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaccatgaggatcgtgcaaaattaggtcgcgaatttggtgcaactgatattgtt
tctgaacgtggcgacgaagcaattgaaaaagttttggaattaactaacggtgtaggtgtt
gatgcagttcaagaatgtgtaggtgcggttagggctattgaacaggctggtaagattgct
cgtccgggcgtggtaattggtcgtgtgggtgttcctcaaacagaaccatcgtcaaatact
ttattctggaagaatactggtcttcgcggtggtattgctaatgttactacctatgacaag
agcatttttgtaaaggctgttcttgaaggtgatattaacccaagcaaggtatttactaaa
cgttttgacttagatcacattcaagaagcatatgaagctatggataaacgtgaagctatt
aagtcactaatcattgttgctgataagtaa

DBGET integrated database retrieval system