KEGG   Lactobacillus acidophilus NCFM: LBA1214Help
Entry
LBA1214           CDS       T00231                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBA1214 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBA1214 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBA1214 (thrC)
Enzymes [BR:lac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBA1214 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188099..1189589
Genome map
AA seq 496 aa AA seqDB search
MKYRSTRGSKDNTLNSPSAIIQGLAPDGGLYVPLNFPEPNFKLEDLPKLSYKQIAAMVIA
LFFNDFSKEQIISSVTNAYNKQWDDRSVVPIEKHNGNFYMELFHGPTLAFKDIALQMLPQ
LMTRAVQIEKINRDIIILTATSGDTGTASMRGFANQKGTDVIVFYPEGGVSPVQLKQMLS
QRGKNLQAFAIKGNFDDAQTEVKKIFNDEAFRERLKQNGYQFSSANSMNIGRLIPQISYY
LYTYGQLVRRKEINLGDKVNFSVPTGNFGDILAGYYAKKLGLPINKLICASNENNVLTDF
FETGEYDKRRKFHLTNAPAMDILVSSNLERLLFDLYDENDKQIASLMNQLTQRGHYQVNE
DVLNELHQIFAADFANENQVKEEIKRVYNYDRYVIDPHTAIGSYVAQQYKQKTNDDTPMV
IVSTASPYKFPETVYEAITGRDCPQSGVAAIKKLHEELGGQLSIGVRALFDHEAHMEKII
NPENMEAAISSILNLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcgtagtactagaggttcaaaagacaatacacttaattcaccatctgctatt
attcagggcttagccccagacggtggtctttatgtacctcttaattttccagagcctaat
tttaaacttgaagatctaccaaaattatcttataagcaaattgccgcaatggttattgct
ttatttttcaatgacttttcaaaagaacaaattatatcatcagtaactaatgcatataac
aaacaatgggatgatcgcagtgttgttccaatcgaaaagcacaatggtaacttctatatg
gagctttttcatggacctactttagcctttaaagatatcgctttacaaatgttgccacaa
cttatgacccgagcagttcaaatcgaaaaaattaatcgtgatattatcatcttgactgcc
acatcaggtgacactggaacagcttcaatgcgtggttttgctaaccaaaaaggcaccgat
gtaattgtcttttatcctgaaggcggtgtaagccctgttcagcttaaacaaatgcttagt
caacgtggtaaaaatctacaagcttttgctattaaaggtaattttgacgatgcccaaact
gaagttaaaaagatttttaatgatgaagcatttagagagcgtttaaaacaaaatggatat
caattttcatctgcaaattctatgaatattggtcgtcttattccacaaatttcttattat
ctttatacatatggtcaattagttcggcgtaaagaaatcaatttaggtgataaagttaac
ttttctgttcctactggtaatttcggggacattttggctggttactatgctaaaaagctt
ggcttaccaattaataaattgatctgcgcttcaaatgaaaacaatgttttaaccgacttt
tttgaaactggtgaatatgataaacgtcgtaaattccatttaactaacgcaccagcaatg
gatattttagtatctagcaatttagagcgtcttttatttgatctatacgatgaaaatgat
aaacaaattgctagcttaatgaatcagcttactcaacgtggtcattatcaagttaatgaa
gacgttttaaatgaattacaccaaatttttgcagcagattttgctaatgagaatcaagtt
aaagaagaaattaagcgtgtatacaattatgatcgctatgtaattgatcctcacactgct
attggttcatatgtcgctcaacaatataagcaaaaaaccaatgatgatactccaatggtc
attgtttccactgctagtccatataaattccctgaaactgtttatgaagcaattacaggg
cgagattgtccgcaaagtggtgttgcagctattaaaaaacttcacgaagaactaggtggt
caactttcaattggcgttagagctttatttgatcacgaagcacatatggaaaaaattatt
aatcctgaaaatatggaagcagctattagttccattttgaatttaaaataa

DBGET integrated database retrieval system