KEGG   Lactobacillus acidophilus NCFM: LBA1438Help
Entry
LBA1438           CDS       T00231                                 

Gene name
melA
Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac00052  Galactose metabolism
lac00561  Glycerolipid metabolism
lac00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LBA1438 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBA1438 (melA)
   00600 Sphingolipid metabolism
    LBA1438 (melA)
Enzymes [BR:lac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LBA1438 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 dDENN
Motif
Other DBs
NCBI-GeneID: 3252915
NCBI-ProteinID: YP_194294
UniProt: G1UB44
Structure
PDB: 

Jmol
Position
complement(1423951..1426149)
Genome map
AA seq 732 aa AA seqDB search
MTSNLIKFDDQNKVFHLHNKQISYLLSIEDGGTLSHLYFGGAVKNYNNQLKYPRLDRGFS
GNLPESLDRTFSRDSLPKEYSSAGEMDFHTPATIVRNPDGSNALFLAYKSYKIEDGKPDL
KGLPHSWTKEDDEAQTLIVTLEDKVSKLEYDLLYTIYRDRPVIVRSVQVHNHGEEAVYLE
KVASMQMDYVDKDFEVITLPGAHANERRVQRENIGQGIKVFSSYRGTSSHQMNPFMALVD
HDTNEFMGEAYGFALAYSGNHKFEVERDQFGQIHVNTGINDYNFKWKLNPNEEFQTPEVL
MVYSDQGLNKMSQAFHSLIHERIMRSKFKDQIRPVLVNNWEATYFDFNEDKLKTIVDKAK
KLGLEMFVLDDGWFGHRDDDNSSLGDWKVYKKKFPNGLGHFADYVHEQGLKFGLWFEPEM
ISYESNLYKEHPDYLMHVPGRKPCPSRNQYVLELGRKEVRDNIFEQMVKILDSKKIDYIK
WDMNRSLSDIYESDLPADQQGEAYHRYVLGYYDLLNKLVTRYPDILFEGCSGGGGRFDVG
QAYYTPQIWASDNTDAIERLKIQYGTSLVYPQSMMTSHVSVSPNEQNGRITPFNTRGAVA
MWGDLGYELDLTKMSDEESDQVVKQVTEYKKIREVTQFGTLYRLKASASNQCAWMMVDSN
KNEAVVTVVNVMAHAQPYCTKTKLAGLDPDKRYKNLETDEVFGGDELMHLGFYDPIERGD
FKAKMYHFKAIN
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtaacttaattaaatttgatgatcaaaataaagtatttcatttacataacaag
caaatatcatatttgctttctattgaagatggtggcacattaagtcatttatactttggt
ggagctgttaaaaattacaataatcaattaaagtatcctagattagaccgcggattttca
ggaaatttgcctgaatcgcttgatcgtacattttcacgtgattcacttccaaaagaatat
agtagtgctggtgaaatggactttcatactcctgctacaatagtacgtaatccagatggc
tcaaatgctttgtttttagcttataagtcatacaaaatcgaagatggtaagccagattta
aagggattaccacactcttggacaaaagaagatgacgaagcgcaaacgttaatagttact
cttgaagataaggtaagcaagctagaatatgacttattatatacaatttatcgagatcgt
cctgtaattgtacgttcagttcaagttcataatcatggtgaagaagcagtatatctcgaa
aaagttgcttctatgcaaatggattatgtagataaggattttgaagtcattactttaccg
ggtgctcatgcaaatgagaggcgtgtgcaaagagaaaatattggtcaaggaattaaagtg
ttttctagttatcgtggcacatcaagtcaccaaatgaatcctttcatggcattagtagat
catgataccaatgaatttatgggtgaagcttatggttttgcactagcatattccggtaat
cataaatttgaagttgaacgtgatcaatttggtcaaatccacgtgaataccggaattaat
gattacaattttaaatggaaattgaatccaaatgaagaatttcaaactccagaagttttg
atggtttattctgatcaaggattaaataaaatgagtcaggcatttcatagcttgatccat
gaacgtattatgcgtagtaaatttaaggatcaaattagacctgttctggttaacaactgg
gaagcaacttattttgatttcaatgaagataaattaaaaactattgtcgataaggctaag
aaattaggcctagaaatgtttgtcttagatgatggttggtttggtcatcgtgacgatgac
aacagttctttaggagattggaaagtttataagaagaagtttcctaatggattaggacat
tttgcagattatgttcatgaacaaggattaaagtttggactatggtttgaaccagaaatg
atctcatatgaatcaaatctatataaagaacatccagattatttaatgcatgtacctggt
agaaagccgtgtccgtcaagaaatcaatatgtcctagaacttggtcgtaaagaagttcgt
gataatatctttgagcagatggtaaaaatcctagatagtaaaaagattgattatattaaa
tgggatatgaaccgtagtttgtctgatatttatgaatcggatttacctgctgatcaacaa
ggagaagcatatcatcgttatgtattaggttattacgatttattaaataaattggtaact
agatatcctgatattttatttgaaggatgctctggtggtggcggtagatttgatgtcgga
caagcttattacacaccacaaatttgggctagtgacaatactgatgctattgaaagatta
aagattcaatacggtactagccttgtttatccgcaatcaatgatgacatcacatgtttca
gtatcacctaatgaacagaatggaagaattactccatttaatacacgtggggctgtagca
atgtggggcgacttaggctatgaacttgatttaaccaagatgagtgatgaagaaagtgat
caagttgttaaacaagtcacagaatataagaaaattagagaagttacccagtttggtacg
ctttatcgtttaaaggcttcagcaagcaatcaatgtgcatggatgatggttgattctaat
aagaatgaagcagttgtaactgtcgtcaatgtaatggctcacgctcaaccatattgtacg
aagacaaaattagctggtcttgatccagataaacgatacaagaatttagaaactgatgaa
gtttttggtggcgacgagctaatgcaccttggcttttatgatcctattgaacgtggtgat
tttaaagccaaaatgtatcattttaaggctatcaattag

DBGET integrated database retrieval system