KEGG   Lactobacillus acidophilus NCFM: LBA1467Help
Entry
LBA1467           CDS       T00231                                 

Gene name
lacL
Definition
beta-galactosidase large subunit (lactase) (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lac00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lac00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lac00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1450020..1451906
Genome map
AA seq 628 aa AA seqDB search
MQANIKWLDDPEIFRVNQLPAHSDHPFFKNYREWQNNHSSFKQSLNGMWQFKFSKDPQSR
PVDFYKKDFNTSSFTTIPVPSEIELNNFAQNQYINTLYPWEGKIFRRPAYALNKSDAEEG
SFSEGKDNTVGSYIKHFDLNPELRDHDIHIVFEGAERAMYVWLNGHFIGYAEDSFTPSEF
DLTKYIKEKDNILAVEVFKHSTASWLEDQDMFRFSGLFRSVELLAFPETHLVDLDLKPTV
CDNYQDGIFNAELKFTGSLNGHVHLSVEDVNGSAILEQDVPLDSEVEFTSSTLENIHLWD
NHHPYLYQLLIEVHDENGHLVELIPYQFGFRRIEINQDKVILLNGKCLIINGVNRHEWNA
KTGRSITLNDMEKDIDTFKENNINAVRTCHYPNQIPWYYLCDQNGIYMMAENNLESHGTW
QKMGQVEPSDNVPGSVPEWREAVIDRARNNYETFKNHTSILFWSLGNESYAGSNIVAMNE
FYKEHDSSRLVHYEGVVHRPELKDQISDIESHMYLPPKEVAEYLRNNPQKPFMECEYMHD
MGNSDGGMGSYIKLIDEYPQYVGGFIWDFIDQALLVYDPISKQNVLRYGGDFDDRHSDYE
FSGDGLMFADRTPKPAMQEVRYYYGLHK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaacataaaatggcttgatgaccctgaaatttttagagtcaatcaattgcca
gctcatagcgatcatcctttttttaagaattatcgtgaatggcaaaataatcacagtagt
tttaagcaaagtttaaatggaatgtggcaattcaaattttctaaagatccccaaagccgt
cccgttgacttctacaaaaaggactttaacacttcatctttcaccacaatcccagttcct
agtgaaattgaattaaacaattttgcacaaaatcaatacattaatactctttatccctgg
gaagggaaaattttccgtcgtcctgcttacgcattaaataaatctgatgctgaagaaggt
tctttcagtgaaggtaaagataacaccgtcggttcatacataaaacattttgacctaaat
ccagaattaagggatcatgatattcatatcgtattcgaaggtgccgaacgagccatgtat
gtttggttaaacggccatttcattggatatgccgaagatagctttactccttcggaattt
gatttaaccaagtatattaaagaaaaagacaatatcttagctgttgaagtttttaaacac
agtacggcttcttggcttgaagatcaagacatgttcagattttctggtctatttagatcc
gttgaattactagcatttcctgaaacacatttagttgatttggatcttaaacctactgtt
tgtgacaactatcaagatggtattttcaatgctgaattaaaatttactggttcactcaat
ggtcatgttcacttatccgtagaagacgtcaacggctcagctattttagaacaagatgtc
ccacttgactccgaagttgaatttactagctcaactttggaaaatattcatttatgggac
aatcatcatccttacttgtatcagttattgattgaagtccatgatgaaaatggtcaccta
gttgaattaattccttaccaatttggctttagacgaattgaaattaatcaagacaaggta
attttactcaacggcaaatgcctaattattaacggagttaatcgccatgaatggaatgcc
aaaactggccgtagcattaccctgaacgatatggaaaaagatatcgatactttcaaagaa
aacaatatcaacgctgttagaacttgccattatcccaaccaaatcccatggtattatctt
tgcgatcaaaacggcatttatatgatggcagaaaacaacctggaatctcatggtacctgg
caaaagatggggcaagttgaaccatctgataatgtacctggttctgttcctgaatggcgt
gaagcagtaatcgatcgcgcccgcaataattatgagactttcaaaaatcatacatccatc
ctattctggtcattaggaaacgaatcttatgccggtagtaatatcgttgcaatgaacgaa
ttttacaaagaacatgattcttctcgtctagttcactacgaaggtgtcgttcatagacca
gaattaaaagatcaaatttctgatattgaaagccatatgtatctaccacctaaagaggtc
gcagaatacttaagaaataacccacaaaaaccatttatggagtgtgaatacatgcatgac
atgggtaattctgatggtggtatgggcagctatattaaattaattgatgaatacccacaa
tatgtaggaggatttatttgggactttattgatcaagcgctcttagtctacgatcctatc
agtaaacaaaacgttctccgttatggtggcgattttgatgatcgtcactcagactatgaa
ttttctggtgatgggttaatgtttgcagatagaacaccaaagccagcaatgcaggaggtt
agatattactatggcttacacaaataa

DBGET integrated database retrieval system