KEGG   Lactobacillus acidophilus NCFM: LBA1468Help
Entry
LBA1468           CDS       T00231                                 

Gene name
lacM
Definition
beta-galactosidase small subunit (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LBA1468 (lacM)
  Lipid metabolism
   00600 Sphingolipid metabolism
    LBA1468 (lacM)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LBA1468 (lacM)
Enzymes [BR:lac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LBA1468 (lacM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451890..1452840
Genome map
AA seq 316 aa AA seqDB search
MAYTNNLQIIYGDATLGITGKNFHYLFSYERGGLESLNINNKEWLYRVPTPTFWRATTDN
DRGNGFNLKASQWLGADMFTKCTKIELKVDDRQFDELPIAPINNQFSNHEYADHVQIAFW
YQTLTNPATDVKIIYNIDNTGCINIVMHYFGKKGLPPLPVIGMRFIMPTAATGFDYEGLS
GETYPDRMAGAKEGKFHVDGLPVTKYLVPQENGMHMQTKALKITRSSTLNNADQESEFSL
KLKQDKQPFNFSCLPYTAEELENATHLEELPLARRTVLVIAGAVRGVGGIDSWGADVEKQ
YHINPEKDYEFSFNLN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacaaataatttacaaatcatctatggtgatgccactttaggaatcactggt
aaaaacttccattatcttttcagctacgaacgaggtgggttagaatcactcaacatcaat
aacaaagaatggttatatcgtgtgccgacccctactttctggcgagctactaccgataat
gatcgaggtaatggctttaatttaaaggcatctcaatggctcggtgctgatatgtttact
aaatgcactaaaatcgaattaaaggtagatgaccgacaattcgacgaacttccaattgct
ccaattaataatcaattcagtaatcatgaatatgctgaccatgttcaaattgcgttttgg
tatcaaactctaactaatccagcaactgacgttaaaatcatttataatattgataatact
ggttgtattaatatagtcatgcattattttggtaaaaaaggattgccaccattaccagtg
attggaatgcgtttcatcatgccaactgctgcaactggctttgactacgaaggactttcg
ggggaaacttatcctgaccgaatggctggtgcaaaagaaggaaaattccatgttgatggc
ttaccagtaactaaatatttagtaccacaagaaaacgggatgcatatgcaaactaaggca
ctcaaaatcactcgttcttctactttaaataatgctgatcaagaaagtgaatttagtcta
aagcttaagcaagataaacaaccgtttaattttagttgtttaccctacactgctgaagaa
ttagaaaatgctactcatctcgaggaattaccacttgctcgcagaactgtgttagttatt
gctggagctgtgcgcggcgttggtggtatcgacagctggggtgctgatgttgaaaagcaa
tatcacattaatcctgaaaaagactacgaattttctttcaatcttaattaa

DBGET integrated database retrieval system