KEGG   Lactobacillus acidophilus NCFM: LBA1485Help
Entry
LBA1485           CDS       T00231                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBA1485 (rbsK)
Enzymes [BR:lac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LBA1485 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase MoaE
Motif
Other DBs
NCBI-GeneID: 3251205
NCBI-ProteinID: YP_194336
UniProt: Q5FJ19
Position
complement(1472443..1473369)
Genome map
AA seq 308 aa AA seqDB search
MSSKISILGSINLDSTYHVDKIPLPGETIHVNKKTFAAGGKGANQAVAAKRSGATVSFIG
AVGNDAAGKYMLNELEKEKINLSNVQIKDTAQTGTATVLLDENGQNSILVYAGANGLIDS
SQINKAEDTIANSDYIIAQFETPISAIISAFTIAKKHGVTTILNPAPATTIDNKLLKVTN
IIVPNETESAAITGINVTDEESMQRTARYFREKGVKVTIITLGSRGVYYSSPTENRFISA
YKVNAVDTTGAGDTFIGAMTSVLTTDLLNISAAIDYGQQASSITVQGIGAQPSIPTKEKI
KQVYRMSD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaaagatatctattttgggaagtattaatttggatagcacttatcatgtagat
aaaattccattaccaggtgaaacgattcatgttaataaaaagacatttgctgcaggtggc
aaaggagctaatcaagcagtggcggcaaagcgtagtggtgcaacggtaagctttattggt
gctgtaggtaatgatgctgccggtaaatatatgttgaatgaattagagaaagaaaaaatt
aatttgtcaaatgtgcagataaaagatacagcccaaacggggacagctaccgtcttatta
gatgaaaacgggcaaaatagtattttagtttacgcaggtgctaatgggctaattgatagt
agccagattaataaagcagaagatacaattgcaaattccgattatattattgctcaattt
gaaactccaatttcagcaataatatcagcttttacaattgcaaaaaaacatggcgttaca
acaattctaaatccggctcctgctactacaatagataataaattgctgaaagttacaaat
attattgtacctaatgaaacagaaagtgcagctattactggaataaatgtaaccgatgaa
gaatcaatgcaacgaactgcaagatatttcagagaaaaaggagtaaaagtaactattatc
actttaggctcaaggggagtttactattcaagtcctactgaaaatcggtttatttcagca
tataaagttaatgcagtagatacaactggagctggtgatacatttattggcgccatgact
tctgtattaactactgatttgttaaatatttctgcagcaattgattatggtcaacaagct
tcatcaattacagtacaaggaataggagctcaaccgtctattccaacaaaagaaaaaata
aaacaggtatacagaatgagtgactaa

DBGET integrated database retrieval system