KEGG   Lactobacillus acidophilus NCFM: LBA1492Help
Entry
LBA1492           CDS       T00231                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBA1492 (glpK)
Enzymes [BR:lac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LBA1492 (glpK)
Exosome [BR:lac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBA1492 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479603..1481054
Genome map
AA seq 483 aa AA seqDB search
MSKKYILAIDQSTQGTKAILVDQNNQIFWKAALPHKQIINNQGWVSHDLGEIKENLQKLF
KKVLEQVSPDQLIGLAITNQRESAAAWSKKTGDSLCKTIVWQDNRAEKLIKKISYPELKN
EVKDKTGLALSPYFTGAKWGWMLLNEPRVIQAHENNDLCLGTMDSWLIYQLTDGKSFKTE
PSNACRTQLMNIRTGNWDKNLSEIFGVDLESLPQIVDSNGHFGNTNLFGLLPHPIPILSV
LGDSQAALFAHGCFKAGDFKVTFGTGSSVMLNIGTSLPANINNKLNTSIAWSLNGKPSYV
LEGNINYAGACITWLKDNLHLINTPNETADLALTANPEDHTILIPAFAGLGAPYWKPDMK
AAFVGMTSTTSKKELVRATLNSLVYQIADILSEFKQLYPKVNNEIHTDGGMIHNKYLMQY
LSNITQRIVKVADISELSAVGSAMNAMNHTTGIQSSKAYNTRMNSNIAQKYRQEWSHWIN
ILS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaatatatactagcaatcgatcagagcactcaaggtacaaaggcaatacta
gtagatcagaataatcaaattttttggaaagccgctctgcctcataaacaaattattaat
aatcagggctgggtcagtcatgatctaggcgaaattaaagaaaatctccaaaaattattt
aaaaaagtattagaacaagtttctcctgatcaacttatcggcttagcaatcactaaccaa
cgagaatcggcagctgcttggtctaaaaagactggtgattcactctgtaagacaattgtt
tggcaagataatcgagctgaaaaattaatcaaaaaaatttcttatcctgaacttaaaaat
gaagttaaagataaaactggattagcactttctccatattttaccggtgccaaatgggga
tggatgcttttaaatgagcctcgagtaattcaagctcacgaaaataatgacttatgcttg
gggacaatggacagctggttaatatatcaacttactgacggaaaatcattcaaaaccgag
ccatctaatgcttgcagaactcaattaatgaatattcgaacaggaaattgggacaagaat
ttaagtgaaatatttggagtagatttagaaagccttcctcaaattgtagattctaatggt
cattttggaaatactaacttatttggtctacttccacatcctattccaattttaagtgtt
ttaggcgattcacaagctgcactttttgctcatggttgttttaaagctggtgattttaaa
gttacatttggaactggctcatcagtaatgcttaatataggtacttcattaccagctaat
attaataataaacttaatacctcaattgcttggtctttaaatggcaaaccttcatatgta
cttgaaggaaacataaattatgctggtgcttgcattacctggctcaaagataatttacat
ttgatcaacacacctaatgaaactgctgatttagcgctcactgccaatcctgaagaccat
acaattttaattcctgcttttgctggattaggcgctccttattggaaaccagacatgaaa
gccgcctttgtaggtatgacttctactactagtaaaaaagaattagttagagcaacttta
aattcattagtttatcaaattgctgatattctttctgagtttaagcaactttatccaaaa
gtaaataatgaaattcataccgatggtggtatgattcacaacaaatacttaatgcaatat
ttaagtaacattactcaaagaatagtaaaagttgcagatatttctgagttaagtgccgta
ggtagtgcgatgaatgctatgaatcatacaacaggtattcaatcatcgaaagcttacaat
acacgaatgaattcaaatatcgcgcaaaaataccgacaagaatggagtcattggattaat
attttatcttaa

DBGET integrated database retrieval system