KEGG   Lactobacillus acidophilus NCFM: LBA1552Help
Entry
LBA1552           CDS       T00231                                 

Gene name
purH
Definition
bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
Orthology
K00602  
phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lac00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lac00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1544517..1546058)
Genome map
AA seq 513 aa AA seqDB search
MKRALISVSDKTNLVDFAKGLVQNGYEIISTGGTKKTLDEAGVKTISVEEVTNFPEILDG
RVKTLNPYIHGGLLAKRDDLEHMATLEKLNIKPIDLVCVNLYPFKQTIEKPDVTTEEAIE
NIDIGGPSLLRAASKNYQDVTVVTDKNDYDLVLKEIAEKGNTTLETRAKLAAKVFRATAA
YDAVIANYLTKQVGLEDPEKLTLTYDLKEKMRYGENSHQKAWLYEDAIPKSFSILQAHQL
HGKKLSYNNIKDADEALRCIREFQDEPTVVAMKHMNPCGIGRGDTLEEAWDRAYEADSVS
IFGGVIALNRKVDLATAKKMHKIFLEIIIAPGFDDDALEVLEKKKNIRLLKLDFSKENEP
TRPEIVSVMGGILQQEQDTLVENTDDWKVVTNAQPTEAQLKTMMFALKAVKHTKSNAIVV
ANDERTLGVGAGQPNRIDSAKIAIKHAGDAIDDRAVLSSDAFFPFNDCVEYAAKHGIKAI
VQPGGSIRDKDSIEIADKYGVAMVFTGYRHFRH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagcattaatcagcgttagtgataagaccaacttggtagattttgctaaaggt
ttagttcaaaacggctatgaaattatttctaccggtggtaccaagaagactttggacgaa
gctggtgttaagacaatcagcgttgaagaagttactaattttcctgaaattttagatggt
cgtgtaaagactttaaacccatatattcatggcggacttcttgctaagagagacgatctt
gaacacatggcaactttagagaaattaaacattaagccaatcgatctagtttgcgtcaac
ctttatccatttaagcaaactattgaaaagccagacgttactactgaagaagcgatcgaa
aacattgatattggtggtccaagcctcttgcgtgctgcttcaaagaactatcaagacgtt
actgtcgtaaccgataaaaacgactatgacttagttttaaaagaaattgctgaaaaaggt
aacaccactcttgaaacaagagctaagctagctgcaaaagtctttagagcaaccgccgct
tatgatgcagttattgccaactacttaactaagcaagttggacttgaagatcctgaaaaa
ttgactttgacttatgatttgaaagaaaaaatgcgctatggtgaaaactcacaccaaaag
gcatggctttacgaagatgcaattccaaagagcttctcaattttgcaagcacatcaattg
cacggcaagaagctttcttacaacaacattaaggatgctgatgaagcacttcgttgtatt
cgtgaatttcaagatgagccaaccgttgttgcgatgaagcatatgaacccatgtggtatt
ggtcgcggcgacacgctcgaagaagcatgggacagagcatacgaagcagattcagtttca
atctttggcggcgttatcgctttgaatagaaaagttgatttagccactgctaaaaagatg
cacaagattttcttggaaattatcattgcaccaggctttgatgatgatgcactcgaagtt
ttggaaaagaaaaagaatattagattgcttaaactagacttcagtaaagaaaatgaacca
actcgtccagaaattgtttcagtcatgggtggtattttgcaacaagaacaagatactttg
gttgaaaacactgacgactggaaggtagttactaatgcgcagccaactgaagcacagctt
aagacaatgatgttcgctttaaaagcggtaaaacatactaaatctaatgcgattgtggtt
gctaacgatgagagaactcttggtgttggtgcaggtcagcctaacagaattgattctgct
aaaattgcgattaaacatgctggggatgcaatcgatgatcgtgcagtcctttcatcagat
gctttcttcccatttaatgattgtgtagaatatgcagcaaagcatggcattaaggcaatc
gttcaacctggtggttctattcgcgataaagattcaattgaaatagctgacaagtacggc
gtagccatggtatttacaggttaccgtcactttagacactaa

DBGET integrated database retrieval system