KEGG   Lactobacillus acidophilus NCFM: LBA1719Help
Entry
LBA1719           CDS       T00231                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBA1719
   00052 Galactose metabolism
    LBA1719
   00500 Starch and sucrose metabolism
    LBA1719
   00520 Amino sugar and nucleotide sugar metabolism
    LBA1719
Enzymes [BR:lac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBA1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1754392..1755276)
Genome map
AA seq 294 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAKAAGIEDILIVTGKNK
RAIENHFDSNPELEQDLEATGKVKLLKLTQDITNLGINLYYTRQPHPAGLGDAIYRARSF
VGEEPFVVMLGDDLMKDKITLTKQLMNDYDKIHASTIAVMQVPHKEVSKYGVIDPEGKVD
KDLYNVKKFVEKPAVDKAPSDFAIIGRYLLTPEIFEILENQKPGRGGEIQLTDAIDTLNQ
TQRVFAHVFRGQRFDVGNKEGYLETSIQYGLRHPETRDALKKYIIDLGKKLEKE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagccatcattccagctgcaggtttggggacccgttttctaccagct
actaaagctatgcctaaggaaatgttaccaattgtcgataagccaacaattcaatttatt
gttgaagaagctaaagctgcaggaattgaagatattttaattgttactggtaagaataag
cgagcaattgaaaatcactttgattctaacccagaacttgaacaagacttggaagccact
ggtaaggttaagttattgaaattaactcaagatattactaacttgggaattaatttatac
tacactcgacaaccacatccagctggcttaggtgatgcaatttatcgtgcacgtagcttt
gtgggagaagaaccattcgttgttatgcttggtgatgacttaatgaaggacaaaattaca
ttaactaagcaattgatgaatgattacgataagattcatgcatcaacaattgctgttatg
caggttccgcataaggaagtttccaagtacggtgtgattgatcctgaaggcaaggtggat
aaagatctttacaatgtaaagaaatttgttgaaaagcctgccgttgacaaggcaccaagt
gattttgcaattattggacgttacttactcacaccggaaatttttgaaattcttgagaat
caaaagccaggtcgcggtggtgaaattcaattaactgatgccatcgatactttgaaccag
actcaacgagtatttgcacatgtctttagaggtcaacgttttgatgtaggtaacaaggaa
ggctaccttgaaacctcaattcaatatggtttaagacaccctgaaactcgcgatgctttg
aagaaatatattatcgacttaggcaagaagcttgaaaaggaataa

DBGET integrated database retrieval system