KEGG   Lachnoclostridium sp. YL32: A4V08_15580Help
Entry
A4V08_15580       CDS       T04430                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy00071  Fatty acid degradation
lacy00280  Valine, leucine and isoleucine degradation
lacy00310  Lysine degradation
lacy00362  Benzoate degradation
lacy00620  Pyruvate metabolism
lacy00630  Glyoxylate and dicarboxylate metabolism
lacy00640  Propanoate metabolism
lacy00650  Butanoate metabolism
lacy00900  Terpenoid backbone biosynthesis
lacy01100  Metabolic pathways
lacy01110  Biosynthesis of secondary metabolites
lacy01120  Microbial metabolism in diverse environments
lacy01130  Biosynthesis of antibiotics
lacy01200  Carbon metabolism
lacy01212  Fatty acid metabolism
lacy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lacy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4V08_15580
   00630 Glyoxylate and dicarboxylate metabolism
    A4V08_15580
   00640 Propanoate metabolism
    A4V08_15580
   00650 Butanoate metabolism
    A4V08_15580
  Lipid metabolism
   00071 Fatty acid degradation
    A4V08_15580
   00072 Synthesis and degradation of ketone bodies
    A4V08_15580
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4V08_15580
   00310 Lysine degradation
    A4V08_15580
   00380 Tryptophan metabolism
    A4V08_15580
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A4V08_15580
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A4V08_15580
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A4V08_15580
Enzymes [BR:lacy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A4V08_15580
Exosome [BR:lacy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A4V08_15580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANU47018
UniProt: A0A1C7G3J0
Position
3385599..3386813
Genome map
AA seq 404 aa AA seqDB search
MDKVFILGGLRSYIGVRNSAYRHVPAEHLGAAVLKELAARYQPSKIDMIICGNCVGGGGN
ITRLMALEAGLSESIPSVTVDLQCASSLEAVITAAARIQSGLADLVIAGGFESSSTQPQR
SYNPNHPYVSSHTDNPSGNPAYIHDGSPADNSDVRRTGLSLTYSTAKFIPGPQREDVMLQ
GAEKTICHYHISPGEMDAWVLESHRRAYKAAREGLLDSITVPVYGLDHDEGIRPRLNQRL
LDRLPCVLRDGRYLNAANACTMNDGAAFLLLCSEPYLKKHKLSARFRLANACTVGADPLM
SPASVLPAVKGLLERSGLSMNDMGAIECNEAFAAIDVLMNRAYPDQASRYNQLGGALAYG
HPYGASGAIILLHLMKSMELSESSRGICCAAAAGGIGSAILLEQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtattcatacttggagggctgcgcagctatatcggcgtaagaaacagcgca
taccgccatgtacccgccgagcatctgggcgccgccgtgttaaaggagctggccgcccgg
tatcagccgtcaaagattgatatgattatctgcggcaactgtgtgggaggagggggcaac
attacccgtctcatggccctggaggcaggactttcggaatccattccttccgttacagtg
gaccttcagtgcgcttcctccctggaagccgtcataacagccgcggccaggatacagagc
ggtctggctgatctggtgattgccggaggttttgaaagcagttccactcagccccagcgc
agctataaccctaaccatccatatgtctcctcccatactgataatccttccggcaatccg
gcttacatacatgacggcagtccggctgacaatagcgatgtccgcagaacggggctttcc
ctgacgtacagcaccgccaaatttattcccggcccgcaacgtgaggacgtaatgctgcag
ggtgcggaaaagacaatatgccattaccatataagccccggagaaatggacgcctgggtg
ctggaaagccacaggcgggcgtacaaagctgcccgggaaggccttcttgacagcataact
gtccctgtatacggacttgaccatgatgagggaatccggccccgcctgaaccagcgcctg
ctggaccggctgccctgtgtcctgagggatggccggtatctcaatgccgccaatgcctgt
accatgaatgacggggctgcctttcttcttctctgttcagaaccgtatctgaaaaagcac
aaactctctgcccgtttccgccttgcaaatgcctgtacggttggggctgacccacttatg
agccctgcctccgtgcttcctgctgtcaaaggtcttttggaacgcagcggactctccatg
aatgacatgggagccattgagtgcaatgaggcgtttgccgctattgatgttctaatgaac
cgggcttatccggatcaagcctcccgttataatcagctgggcggcgccctggcctacggg
catccctatggggcttccggcgccattattcttctccatctgatgaagtccatggaactg
tcagaaagcagccgtggcatctgctgcgcggctgccgcaggcggtatcggaagcgccatt
cttctggaacagtaa

DBGET integrated database retrieval system