KEGG   Lactobacillus acidophilus La-14: LA14_0707Help
Entry
LA14_0707         CDS       T02647                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lad  Lactobacillus acidophilus La-14
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LA14_0707
Enzymes [BR:lad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LA14_0707
Exosome [BR:lad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA14_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
667082..668998
Genome map
AA seq 638 aa AA seqDB search
MVTIVEVKQHIKKFAAGNELYLQEVLGCHYENDIYTFRVWAPNAQKVWLVGDFNDWDKSL
EMSQTLDGVWEIKTSLPKEGQLYKFLVKQADGREVMKIDPMAFELEPRPGSAAVIVKLPN
KKWLDGAWMGRNKRSNHFARPINIYEVHASSWKRHTDGSLYTLKDLQKELIPYVKEQGFN
YIEFLPLTAHPLDASWGYQTIGYYALERTYGTPRELQDFVEACHKENIGVLADWVPGHFC
INDDALAYYDGTPCYEFSEKWRAENKGWGALNFDLGKPEVQSFLLSSALFWLEFYHLDGL
RVDAVSNMIYRDYDRSDGEWKTDKFGGNRNLEGIEFLQKLNRTIKGKHPECLMIAEESSA
QVKITGRIEDGGLGFDFKWNMGWMNDILRFYEMDPLFRKFNFNLATFSFMYRMSENFILP
LSHDEVVHGKRSLMNKMFGDRDKQFAQLRNLLTLQMTYPGKKLLFMGSEFGQYLEWRYND
GLDWAELKDELNAKMKHFDQDLNSFYLNEPALWQLEQREDSVQIIDADNKDESVLSFIRQ
GKTRHDFLIVILNFTPVDRKKITIGVPYAGKYCEVFNSARKEYGGSWNQEKQNLKTQNNS
FKNFNYQVQLDIPGFSAVILKPVDVHIKRRINRKTKTK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgatagtggaggttaaacaacatattaaaaaatttgcagctggcaatgagcta
tatcttcaagaagtattagggtgtcattatgaaaatgatatctatacttttagagtatgg
gcaccaaatgcgcaaaaagtttggctagttggcgattttaatgattgggataaatcatta
gaaatgagtcagactttagatggagtttgggaaataaagaccagcttacccaaagaagga
cagctatataagtttctagttaaacaagctgatggtcgtgaggtaatgaaaattgatcct
atggcgttcgaattagagcctagaccaggcagtgcagctgtgattgttaagttacctaat
aaaaagtggcttgacggtgcatggatgggacgaaataaaagatcgaatcattttgctcga
ccaattaatatttatgaagtacatgctagttcatggaaaagacatacagatgggtctctg
tatactttgaaggatttacaaaaggaattaattccgtatgttaaagaacaaggatttaat
tatatcgaatttttgcctttaacagcacatcctttagatgcttcatggggatatcaaaca
attggttattatgctttggagcgtacttatggtacaccacgagagctgcaagattttgtt
gaagcatgtcacaaagaaaacatcggtgttttggctgattgggtaccaggacacttttgt
attaatgatgatgccttggcttattatgatggcacaccatgttatgaatttagcgaaaaa
tggagagccgaaaataaaggctggggagctctaaattttgatttaggcaaaccggaagtg
caatcatttttactttctagtgccctattttggctagaattttatcatttggatggcttg
agagttgatgctgtttctaacatgatttatcgcgattatgaccgcagtgacggtgaatgg
aaaacagataaatttggtggaaatcgtaatttagaggggatagaattcctacaaaaacta
aatcgaaccattaaaggcaaacatccagaatgtttaatgattgccgaggaaagttctgct
caagtaaagataactggtcgaatagaagatggtgggttaggttttgattttaaatggaat
atgggttggatgaacgatattttacgtttttatgagatggacccattatttagaaaattt
aattttaatctagctactttttcattcatgtatcgaatgagtgaaaactttattttacct
ttatcacatgacgaggttgttcatggtaagcgaagcctaatgaataaaatgtttggcgac
cgtgataagcaatttgctcaattacgtaatttacttacattgcaaatgacctatcctggt
aaaaagcttttatttatgggaagtgaatttggacaatatcttgaatggcgatataacgat
ggcttagattgggcagaattaaaggatgaactgaatgctaaaatgaagcattttgatcaa
gatttaaatagtttttatttaaatgagccggctttgtggcaattagaacaaagagaagat
tctgttcaaattattgacgcagataataaagatgagtcagtcttgtcatttattcgtcaa
ggtaaaactagacatgactttttaatagttattttgaattttacacctgttgatcgaaaa
aaaattacaattggtgttccatatgctggtaaatattgtgaagtctttaatagtgccaga
aaagaatatggtggcagttggaaccaagaaaagcagaatttgaaaactcaaaataattca
tttaagaattttaattatcaagtgcaattggatataccgggttttagtgctgtgatttta
aaacctgtagatgttcatataaaaagaagaattaatagaaaaacaaaaactaagtaa

DBGET integrated database retrieval system