KEGG   Lactobacillus acidophilus La-14: LA14_1437Help
Entry
LA14_1437         CDS       T02647                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lad  Lactobacillus acidophilus La-14
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lad00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LA14_1437
  Lipid metabolism
   00561 Glycerolipid metabolism
    LA14_1437
   00600 Sphingolipid metabolism
    LA14_1437
Enzymes [BR:lad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LA14_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1423526..1425724)
Genome map
AA seq 732 aa AA seqDB search
MTSNLIKFDDQNKVFHLHNKQISYLLSIEDGGTLSHLYFGGAVKNYNNQLKYPRLDRGFS
GNLPESLDRTFSRDSLPKEYSSAGEMDFHTPATIVRNPDGSNALFLAYKSYKIEDGKPDL
KGLPHSWTKEDDEAQTLIVTLEDKVSKLEYDLLYTIYRDRPVIVRSVQVHNHGEEAVYLE
KVASMQMDYVDKDFEVITLPGAHANERRVQRENIGQGIKVFSSYRGTSSHQMNPFMALVD
HDTNEFMGEAYGFALAYSGNHKFEVERDQFGQIHVNTGINDYNFKWKLNPNEEFQTPEVL
MVYSDQGLNKMSQAFHSLIHERIMRSKFKDQIRPVLVNNWEATYFDFNEDKLKTIVDKAK
KLGLEMFVLDDGWFGHRDDDNSSLGDWKVYKKKFPNGLGHFADYVHEQGLKFGLWFEPEM
ISYESNLYKEHPDYLMHVPGRKPCPSRNQYVLELGRKEVRDNIFEQMVKILDSKKIDYIK
WDMNRSLSDIYESDLPADQQGEAYHRYVLGYYDLLNKLVTRYPDILFEGCSGGGGRFDVG
QAYYTPQIWASDNTDAIERLKIQYGTSLVYPQSMMTSHVSVSPNEQNGRITPFNTRGAVA
MWGDLGYELDLTKMSDEESDQVVKQVTEYKKIREVTQFGTLYRLKASASNQCAWMMVDSN
KNEAVVTVVNVMAHAQPYCTKTKLAGLDPDKRYKNLETDEVFGGDELMHLGFYDPIERGD
FKAKMYHFKAIN
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtaacttaattaaatttgatgatcaaaataaagtatttcatttacataacaag
caaatatcatatttgctttctattgaagatggtggcacattaagtcatttatactttggt
ggagctgttaaaaattacaataatcaattaaagtatcctagattagaccgcggattttca
ggaaatttgcctgaatcgcttgatcgtacattttcacgtgattcacttccaaaagaatat
agtagtgctggtgaaatggactttcatactcctgctacaatagtacgtaatccagatggc
tcaaatgctttgtttttagcttataagtcatacaaaatcgaagatggtaagccagattta
aagggattaccacactcttggacaaaagaagatgacgaagcgcaaacgttaatagttact
cttgaagataaggtaagcaagctagaatatgacttattatatacaatttatcgagatcgt
cctgtaattgtacgttcagttcaagttcataatcatggtgaagaagcagtatatctcgaa
aaagttgcttctatgcaaatggattatgtagataaggattttgaagtcattactttaccg
ggtgctcatgcaaatgagaggcgtgtgcaaagagaaaatattggtcaaggaattaaagtg
ttttctagttatcgtggcacatcaagtcaccaaatgaatcctttcatggcattagtagat
catgataccaatgaatttatgggtgaagcttatggttttgcactagcatattccggtaat
cataaatttgaagttgaacgtgatcaatttggtcaaatccacgtgaataccggaattaat
gattacaattttaaatggaaattgaatccaaatgaagaatttcaaactccagaagttttg
atggtttattctgatcaaggattaaataaaatgagtcaggcatttcatagcttgatccat
gaacgtattatgcgtagtaaatttaaggatcaaattagacctgttctggttaacaactgg
gaagcaacttattttgatttcaatgaagataaattaaaaactattgtcgataaggctaag
aaattaggcctagaaatgtttgtcttagatgatggttggtttggtcatcgtgacgatgac
aacagttctttaggagattggaaagtttataagaagaagtttcctaatggattaggacat
tttgcagattatgttcatgaacaaggattaaagtttggactatggtttgaaccagaaatg
atctcatatgaatcaaatctatataaagaacatccagattatttaatgcatgtacctggt
agaaagccgtgtccgtcaagaaatcaatatgtcctagaacttggtcgtaaagaagttcgt
gataatatctttgagcagatggtaaaaatcctagatagtaaaaagattgattatattaaa
tgggatatgaaccgtagtttgtctgatatttatgaatcggatttacctgctgatcaacaa
ggagaagcatatcatcgttatgtattaggttattacgatttattaaataaattggtaact
agatatcctgatattttatttgaaggatgctctggtggtggcggtagatttgatgtcgga
caagcttattacacaccacaaatttgggctagtgacaatactgatgctattgaaagatta
aagattcaatacggtactagccttgtttatccgcaatcaatgatgacatcacatgtttca
gtatcacctaatgaacagaatggaagaattactccatttaatacacgtggggctgtagca
atgtggggcgacttaggctatgaacttgatttaaccaagatgagtgatgaagaaagtgat
caagttgttaaacaagtcacagaatataagaaaattagagaagttacccagtttggtacg
ctttatcgtttaaaggcttcagcaagcaatcaatgtgcatggatgatggttgattctaat
aagaatgaagcagttgtaactgtcgtcaatgtaatggctcacgctcaaccatattgtacg
aagacaaaattagctggtcttgatccagataaacgatacaagaatttagaaactgatgaa
gtttttggtggcgacgagctaatgcaccttggcttttatgatcctattgaacgtggtgat
tttaaagccaaaatgtatcattttaaggctatcaattag

DBGET integrated database retrieval system