KEGG   Lactobacillus acidophilus FSI4: SD55_0650Help
Entry
SD55_0650         CDS       T03681                                 

Gene name
thil
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
laf  Lactobacillus acidophilus FSI4
Pathway
laf00071  Fatty acid degradation
laf00072  Synthesis and degradation of ketone bodies
laf00280  Valine, leucine and isoleucine degradation
laf00310  Lysine degradation
laf00362  Benzoate degradation
laf00620  Pyruvate metabolism
laf00630  Glyoxylate and dicarboxylate metabolism
laf00640  Propanoate metabolism
laf00650  Butanoate metabolism
laf00900  Terpenoid backbone biosynthesis
laf01100  Metabolic pathways
laf01110  Biosynthesis of secondary metabolites
laf01120  Microbial metabolism in diverse environments
laf01130  Biosynthesis of antibiotics
laf01200  Carbon metabolism
laf01212  Fatty acid metabolism
laf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:laf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SD55_0650 (thil)
   00630 Glyoxylate and dicarboxylate metabolism
    SD55_0650 (thil)
   00640 Propanoate metabolism
    SD55_0650 (thil)
   00650 Butanoate metabolism
    SD55_0650 (thil)
  Lipid metabolism
   00071 Fatty acid degradation
    SD55_0650 (thil)
   00072 Synthesis and degradation of ketone bodies
    SD55_0650 (thil)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SD55_0650 (thil)
   00310 Lysine degradation
    SD55_0650 (thil)
   00380 Tryptophan metabolism
    SD55_0650 (thil)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SD55_0650 (thil)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SD55_0650 (thil)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SD55_0650 (thil)
Enzymes [BR:laf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SD55_0650 (thil)
Exosome [BR:laf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SD55_0650 (thil)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJP46059
Position
612510..613667
Genome map
AA seq 385 aa AA seqDB search
MKDIYIVAAKRTPFGKYRGFFKDASAVDMGVMALKGTLKASGINPEDVQALFMGNVLETG
LGENMARQVALYSGMKESSAAVTINEVCGSSLKAVRLAQGQMEMGDLDLVAVGGSESMTR
APYFINKEDKDNPEKMTSTMLNDGLMDAFSGKHMGITAENVAEKYNVSREEMDKFSLASH
QKAAKATEAGLLKNEILDVEIDGQVLDHDEPIRPGTSLEALGNLKPVFKEDGQVTAGNAS
PLTDGASMVILATKEKMEELDLTPVAKLGDFAEAGFDPAYMGYTPYFAVKKLLAKTGRSI
NDYDLIELNEAFAAQSIPVARDLEIPMDKLNIMGGAISLGHPLGATGTRLISTAVNGLKN
NDGKLALVTLCIGGGQAIAYEIENV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatttatattgtcgctgctaaaagaaccccttttggcaaataccgtggtttt
tttaaagacgcttctgcagttgatatgggagtaatggcacttaaaggaactttaaaagca
agtggaattaatcctgaagatgtgcaagctttatttatgggaaatgttttagaaacagga
cttggtgaaaatatggctcgtcaagttgctctttattcgggaatgaaggaaagctctgct
gcagttacaattaatgaagtttgtggatcgagtttaaaggccgtccgactcgcacaaggt
caaatggagatgggagatcttgatttagtagccgttggtggaagcgagagtatgactcgt
gcaccatattttatcaataaagaagataaagataatccagagaagatgaccagtacaatg
cttaatgacggtctaatggatgctttttcaggtaagcacatgggaattactgcagaaaat
gttgcagaaaaatataatgtttcgcgtgaagaaatggataaatttagtttagcatcacat
caaaaggctgctaaagctactgaagctggtttgttaaaaaatgaaattttggatgttgag
attgatggtcaagtattggatcacgatgaaccaattcgtccaggcactagcttagaagca
ttgggtaatttgaagccagtatttaaagaagatggtcaagtaacagccggaaatgcttca
cctcttactgacggtgccagcatggtgattttggctactaaagaaaagatggaagaatta
gatttaactcctgttgctaaattaggtgattttgcggaagccggttttgatcctgcatat
atgggatataccccttactttgctgtaaagaagctattagccaaaactggtcgttcaatt
aatgactatgatctaattgaattaaatgaagcttttgcagcacaaagtattccagttgca
cgagacttagaaattccgatggataagttaaatatcatgggaggagcaatttctcttggt
cacccattaggtgcgacgggtactcgtttgattagtacagcagttaatggattgaaaaat
aatgatggcaagttggctttagtcactctatgtattggtggtggtcaagcaattgcttat
gaaatcgagaacgtgtaa

DBGET integrated database retrieval system