KEGG   Listonella anguillarum M3: N175_01990Help
Entry
N175_01990        CDS       T02823                                 

Definition
5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lag  Listonella anguillarum M3
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lag03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:410277..411086
Genome map
AA seq 269 aa AA seqDB search
MPELPEVEVSKMGISPHLVGQTIQQLTFRTPKLRWAIPQELKQLEGQVIRNIARRAKYLL
IETDIGSAIVHLGMSGSLRVLECDFPAGKHDHVDLRLTNGKVLRYHDPRRFGAWLWCEQG
ASHSVLSNIGPEPLTDDFDADYIVQKANNKRIAVKQFIMENKVVVGVGNIYASESLFNAR
ILPTRPAHSLTLTEWNCLVREIKSVLATAIQQGGTTLKDFAQADGKPGYFAQELNVYGKA
QQPCPACGQAIEALKIGQRNTFFCSACQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttacccgaagttgaagtaagtaaaatggggattagcccgcatctagttgga
caaacgatccagcaactgacatttcgcacgccaaaattacgttgggccatccctcaagag
ctgaaacagttagaagggcaagtgatccgcaatattgcccgccgggccaaatatttattg
atagagaccgatattggcagtgcgattgttcacttgggaatgtcaggttcattgcgagta
ttggagtgtgattttccggcaggtaagcatgatcacgttgatctgcgattaaccaatggc
aaggtactgcgctaccacgatcctcgtcgatttggcgcttggctatggtgcgaacaagga
gcaagccactcggtgttgagtaatatcggtcctgagccattaaccgatgattttgatgca
gattatattgtgcaaaaagcgaacaataaacgtatcgctgttaagcaatttattatggaa
aataaagtagtggttggcgtaggcaatatctacgcgagtgaatcactgtttaatgcgcga
attctccccactcggcccgctcattcgctgacactgactgagtggaattgcctcgtgcga
gaaattaaatcagtcttagcaacggcgattcaacaaggtggcacaaccttaaaagatttt
gcacaagcggatggcaaaccgggctattttgctcaagagcttaatgtgtatggcaaagcg
cagcagccttgcccagcgtgtgggcaagcgattgaagcgctgaaaattggtcagcgtaac
acctttttctgctctgcttgccaaaaataa

DBGET integrated database retrieval system