KEGG   Listonella anguillarum M3: N175_02760Help
Entry
N175_02760        CDS       T02823                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lag  Listonella anguillarum M3
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Class
Metabolism; Overview; Carbon metabolism [PATH:lag01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lag00620]
Metabolism; Energy metabolism; Methane metabolism [PATH:lag00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(571125..573791)
Genome map
AA seq 888 aa AA seqDB search
MDVIFLQGRMTMNEKYAALKSNVSMLGRLLGNTIQDAHGDVILEKVETIRKLSKSARNGN
QADRDSLVEEIKNLPNEQLTPVARAFNQFLNLTNMAEQYHTISRHCEEHVCEPDAINLLF
TKLNQNKISKLDAAQAVRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSFK
ERQKTERRLEQLIAQSWHSDVIRKQRPTPLDEAKWGFAVVENSLWQAVPDFLREFDEHLT
NYLGEGLPIDARPVHFSSWMGGDRDGNPFVTHKITREVMLLSRWKAADLYLGDINELVSE
LSMTKCSDALRDLAGIDEHEPYRAILKRLRELLSETLEVLDAKINGQQLARKAPLQNIAQ
LWEPLYACYQSLHQCGMGVIADGSLLDTLRRIKAFGVHLVRLDIRQESTRHSDVISELTR
YLGIGDYDQWSEQDKIAFLTNELSSKRPLLPRDWQPSEAVQEVIDTCKIVASQPREAFGA
YVISMARTASDVLAVHLLLQECGCPYRMDVCPLFETLDDLNNAETVIRQLMGIDLYRGFI
QNHQMVMIGYSDSAKDAGVMSAGWAQYSAMEALVNVSEEAGIELTLFHGRGGTIGRGGAP
AHAALLSQPPKSLKGGLRVTEQGEMIRFKLGLPEVAVNSFTMYASAILEANLLPPPEPKQ
DWRDLMEVLSEVSCEAYRHIVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVES
LRAIPWIFSWSQNRLVLPAWLGAGEAIQFSIDKGHQALLEEMCREWPFFSTRLGMLEMVY
SKCNIEISRYYDERLVDESLRPLGERLRSQLQKDIKAVLNVENNENLMQSDPWGQESIRL
RNIYVEPLNMLQAELLYRTRQTETAPAELEEALMVTIAGIAAGMRNTG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaatttttttacaaggcaggatgacaatgaacgaaaaatacgctgcgctcaaa
agtaacgtgagcatgcttggccgtttgctgggcaacaccattcaggacgcccatggtgac
gttatcttagagaaagtggaaaccatccgaaaactttcaaaatcagcccgtaatggcaat
caagccgaccgagacagcttggttgaagagatcaaaaaccttcccaacgaacagctcacc
ccagtagcgcgggcattcaaccaatttcttaacttaaccaacatggccgagcagtaccac
actatttcacgtcactgtgaagaacatgtgtgtgagcctgatgcgattaatttactgttt
actaaactgaatcaaaataaaatcagtaaattggatgctgctcaagcggtacgcgatctc
aatatcgagttagtactaacggctcacccaaccgaaattacacgccgcacgatgatcaac
aagctggtgaaaattaacgagtgtctctccaagcttgaactcagtgacctttcatttaaa
gagcgccaaaaaaccgaacgtcgtttagaacagttgatcgcgcaaagctggcattcagat
gtgattcgtaagcagcgccctacgccactggatgaagcaaaatggggctttgcggtggtg
gaaaattctctatggcaagccgtgcctgattttcttcgtgaatttgatgagcacctcacc
aactacttaggtgaagggctaccaattgatgcacgccctgtgcatttctcttcgtggatg
ggcggcgaccgtgatggtaacccctttgtgactcataaaatcacccgtgaagtaatgctg
ctttctcgctggaaagcggccgatctctacctaggtgatatcaatgagctggtcagcgaa
ttgtcgatgaccaaatgcagtgacgcgctacgcgatttggctggcatagatgaacacgaa
ccttatcgcgccattctcaaacgcctgcgtgaactgctcagcgaaacactggaagtgttg
gatgccaagatcaatggccaacaactggcacgcaaagcaccgctacaaaatatcgcacag
ttgtgggaaccgctttatgcctgctaccaatctttacatcaatgcggcatgggcgtcatt
gccgatggctcgctgcttgatactctgcgccggattaaagcgttcggcgtgcatcttgta
cgtttggacattcgccaagagagcactcgtcactctgatgtgatctccgagctcacccgt
tatttaggtattggtgattatgaccagtggagcgagcaagacaaaattgcgtttctcacc
aatgagttgagctcaaaacgtcctttgttacctcgtgactggcagccttcagaagcggta
caagaggtgatcgacacctgtaaaatcgttgcttctcagcctcgcgaagcctttggtgct
tatgtgatttcgatggctcgtaccgcatcagatgtacttgccgtacatctattgttgcaa
gagtgtggctgtccttatcgcatggacgtttgtccactgttcgaaactttggatgattta
aacaacgcagaaacggtgatccgccaactaatgggcattgatctctatcgtggctttatt
caaaaccaccagatggtgatgattggttactctgattctgctaaagatgcaggtgtaatg
tccgccggttgggcgcaatacagcgcaatggaagctttggttaatgtcagtgaagaggcc
ggaattgaactgacactattccatggacgtggcggcaccattggtcgcgggggcgctcca
gcacatgcggcactgctttcacaaccacccaaaagcttaaaaggtggcttgcgtgtgacg
gagcaaggcgaaatgatccgctttaagcttggtctaccagaagtagcggtcaatagtttt
acgatgtacgccagcgccattttagaagcgaacctgctgccaccaccagagccaaaacaa
gattggcgcgacttaatggaggtattgtctgaagtctcttgcgaagcgtatcgtcatatt
gttcgcggcgagccggactttgtcccgtacttccgccaagcaacgccagagctagagctg
ggtaaattaccgctcggttcacgtccggctaaacgcaaccctaatggtggggtcgaaagc
ttacgtgcaatcccgtggatcttctcttggagccaaaaccgcctcgtgctaccagcctgg
ctaggtgcgggagaagcaattcagttttctatcgataaaggacaccaagcactgctggaa
gagatgtgccgtgaatggccatttttctcaacgcgtttgggcatgctagagatggtttac
tccaagtgcaacattgaaatctcacgctattacgatgaacgcttagtcgatgaatcgtta
cgcccgctcggtgagcgtttgcgttctcaattacagaaagacatcaaagcggtgttaaat
gtagaaaacaatgagaacttgatgcaaagcgatccttggggtcaagagtcaatccgtttg
cgcaatatctatgttgagccattaaatatgctgcaagcagagctgttgtaccgcacccgc
caaaccgaaaccgcaccagcagagttagaagaagccttaatggtgactatcgcgggtatt
gcagcaggaatgcgtaacacaggctaa

DBGET integrated database retrieval system