KEGG   Listonella anguillarum M3: N175_04275Help
Entry
N175_04275        CDS       T02823                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
lag  Listonella anguillarum M3
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lag00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:881438..882799
Genome map
AA seq 453 aa AA seqDB search
MLGRQLMYSTQTFLPQEIIRKKRDGEILTTEEINFFIQGVANNTVSEGQIAAFAMTIFFN
EMTMPERIALTCAMRDSGMVINWDAMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFV
PMISGRGLGHTGGTLDKLESIPGYNITPSNDVFGQVTKEAGVAIIGQTGDLAPADKRVYA
TRDITATVDNISLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEASEELAKSIVAVAN
GAGTKTTAILTDMNQVLASSAGNALEVREAVRFLTGEYRNPRLLEITLASCVEMLLLGNL
AKDSNDARAKLMAVLNNGKAAECFGKMVKGLGGPADFVENYDHYLEKTELVKPVYALESG
VVSAMDTRAIGMAVVEMGGGRRVATDTIDYAVGFDQFIRLGDVADSSKPLAVIHARNEAQ
WQQAAKALQSAIQIGGEYTPTPDVYGQIRAEDV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcttgggaggcaactaatgtactcaactcaaacttttttacctcaagaaatcattcgc
aaaaagcgtgacggcgagatcctcaccaccgaagaaattaacttttttattcaaggtgtg
gcgaataataccgtctctgaaggccaaattgcggcctttgccatgacgattttcttcaat
gaaatgactatgccagagcgcattgcactgacgtgcgctatgcgtgattctggaatggtg
atcaactgggatgcgatgaacttcggtggccctatcgttgataaacactcaactggcggc
gtaggcgatgtcacttcgctgatgcttggccccatggtcgcagcctgcggtggttttgtc
cctatgatttcagggcgcggccttggtcatacgggcggcacgctggataaattggagtcg
attcccggttataacatcactccaagtaatgacgtatttggtcaagtaaccaaagaagcg
ggcgttgctatcatcggccaaacgggtgatctcgcgccagcggataaacgcgtatacgcc
acacgtgacattaccgcaacggtcgacaacatttcactcatcaccgcctcgattctttct
aaaaaattagccgctgggttagattccttggtgatggatgtcaaagtcggctctggcgca
tttatgccgacttacgaagcttctgaagagttagctaaatctatcgtcgcagtggctaac
ggcgctggtacgaaaaccacggctattttaacggatatgaaccaagtgctggcctcttcg
gcaggcaatgcccttgaagtgcgtgaagcggtacgctttttaactggtgaatatcgcaat
cctcgcttactggaaattaccttggcctcttgcgttgaaatgttgttattaggcaattta
gcaaaagacagcaatgatgctcgtgcgaaactgatggccgttcttaataacggaaaagcg
gctgaatgctttggcaaaatggtcaaagggttaggcggccccgctgattttgttgaaaat
tacgatcactatcttgaaaaaaccgagctggttaagcccgtttacgctctagaaagtggc
gtcgtatcggcaatggatactcgcgcgattggcatggccgtggtggagatgggcggtgga
cgccgcgtcgcaactgacactattgattacgcggttgggtttgaccaatttattcgccta
ggtgacgttgccgatagcagtaagccgttggcggtgatccatgcgcgtaatgaagcgcaa
tggcaacaagcggccaaagcattacaaagcgccattcaaattggcggagaatacacacca
acacccgatgtctacggccaaattcgcgcagaagacgtataa

DBGET integrated database retrieval system