KEGG   Vibrio anguillarum M3: N175_08575Help
Entry
N175_08575        CDS       T02823                                 

Definition
NAD-glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
lag  Vibrio anguillarum M3
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lag00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    N175_08575
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N175_08575
   00330 Arginine and proline metabolism
    N175_08575
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    N175_08575
Enzymes [BR:lag01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     N175_08575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1804129..1808970)
Genome map
AA seq 1613 aa AA seqDB search
MTARETLVPVLLEKVYKLIQDKLDLAHQPLVTQLAQHLFSNISKDDLTERNESDLYGAIV
SLWHHINEKNPEERSVRVFNPTVSRQGWQSTHTIVEIVIPDSPFLVDSIKMALSRLDLSS
HLMLNGPTQISRTDNGVITSVNQGEGVLQSLFHIEVDRLSSKEAMTQLKNELLSILSDTA
LVVQDWQPMSEKLVQVIAQLETQKEFIPVESDRYEETIKFLKWMGNHNFTFMGYKEYDLV
TVEGDTELRPTAEKGLGLFSDSKRVRSVKLSDFPDSARLEAKKPFLLIVTKGNTQSRIHR
PAYTDYIGVKKFDKAGKVIGEHRFTGLYTSAVYNQSVETIPLIREKVERILKASGYRAGS
YSYKALHNILENYPRDELLQAREEEMLEVGMGVVQMQDRDLLRLFVRKDPFGRFFSCMVY
VTKERYNTELRRQTQRIFKQYFGCEQDVEFTTYFSESPLARTHYIVRVDNNNMDVDVKTV
EQNLMEASSTWDDRLSDAIVANFGESKGLPLSKEYMRAFPRSYKEDMMPGSAVDDIQRLE
ALDEEHKLGMLFYRPQEEAADSKAVRLKLYHRDEPIHLSDVMPMLENLGLRVIGESPYEV
RKLNGQTYWILDFSMLHKSDKSVDLREARDRFQQAFAAIWAGELESDGFNRLVLGASLTG
REVSILRAYARYMRQVGFPFSQQYIEDTLSHYPDVAKGLVELFLKRFDPKHKGAQKGQTD
LINAITEELDRVDSLDDDRIIRRYMEMISATIRTNYFQLDENNQIKPWLSLKMKPKEISE
IPAPVPAFEIFVYAPDIEGVHLRGGKVARGGLRWSDRQEDFRTEILGLVKAQQVKNTVIV
PVGAKGGFVCKKQHMFTTRDEIFAEGQRCYKRFIRALLDVSDNIIEGEVVPPKNVVRHDE
DDPYLVVAADKGTATFSDLANSVSAEYNFWLGDAFASGGSNGYDHKAMGITAKGGWESVK
RHFREMGINCQTTDFTAIGIGDMAGDVFGNGMLLSKHICLQAAFNHLHIFIDPTPNSAKS
WEERNRLFNTPRSSWEDYNAKLISKGGGIFSRKAKSITLTPEIQKMIGTKKASVAPNELI
KMILKMEVDLLWNGGIGTYVKSSKESHSDVGDRGNDALRIDGRDLRTKVIGEGGNLGMTQ
LGRVEYALTGGRVNTDFVDNVGGVDCSDNEVNIKIFLNGLVANGDLTVKQRNQILESMED
EVGGIVIEDAYAQSEAISVTEQQGVSLVKEQIRFIHAMEKAGHLDRALEYIPDDETLLER
EKQGFALTRPELSVLVAYGKMVLKEELACEEISHDEFHSQQLINYFPTELRRNYSQHMQQ
HPLRAEIIATALANQMVNEMGCNFVTRLQEETGANVVDIANAYTAAREIYGLGRVLEQVR
LLDNKAEADAQYDVIFLVRRTLRRLSRWLLRNRSGKQSVKDLIALYQTDVNAVSAELDNM
LVAEEVAEHNAMAQVWIDKGINSELANYVARLSSLYSALDISTVARDKGKTVAQTAKLYF
NLGDRLSLHWFLKQINGQAVDNNWQALARAAFREDLDWQQRQLTAQVLNCTCAPEELDVM
KALDEWIASNEVSLMRWESILNEFKVGAVHEFAKFSVALRELVLLNLNCAANE
NT seq 4842 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgcgtgaaactttagtgccagttctgcttgaaaaagtgtacaaactgattcaa
gacaaactcgatcttgctcatcaaccgctcgtgacccaacttgctcaacatctatttagt
aacatttcgaaagatgatctgactgaacgtaatgaatctgacttatatggtgcgatagtt
agcctatggcaccatattaacgagaaaaacccagaggagcgttcagtgcgggtatttaac
ccgacagtaagccgccaaggttggcagtcaacgcacacgattgttgaaatagtaatccct
gatagtccgtttcttgtggactccattaaaatggcgcttagccgtttggatttatcgtca
cacctcatgctcaatggtccaacgcaaatctcgcgcaccgataacggtgttattacttcg
gtaaaccaaggagagggtgttctgcaatctctttttcatattgaagtcgaccgccttagc
agcaaagaagcgatgacacagttgaaaaatgagttgcttagtattctgagcgatacagct
ttagtggtgcaagactggcaaccaatgtcagaaaaactggtgcaagtgattgcgcaattg
gagacacaaaaagagttcattcctgtagaaagtgatcgttacgaagaaaccatcaaattc
ttaaagtggatgggaaatcataatttcactttcatgggatacaaagaatacgacctcgtg
acggtcgaaggcgatactgagctgagaccaacagcagaaaaagggttgggtttattttct
gattcaaaacgtgtacgcagcgtaaaattatctgactttcctgattccgcgcgccttgaa
gccaaaaagccttttttattgattgtcactaaaggcaatacccaatcacgtatccaccgc
ccagcttataccgattatatcggcgttaaaaagttcgacaaagcaggtaaagtgatcggt
gaacatcgtttcactggtctatatacctcggcggtgtataaccaaagtgtcgaaactatt
ccgctgatccgcgaaaaagtagaacgtatcctaaaagccagcggttatcgtgcaggctcg
tattcctataaagcgctgcacaatattctagaaaactatcctcgtgatgagttactgcaa
gcacgtgaagaagagatgttagaagttgggatgggcgtagtgcaaatgcaagatagggat
ttgctgcgtctgtttgttcgtaaagacccgtttggtcgtttcttcagctgtatggtctat
gtgaccaaagagcgctataacaccgagcttcgccgccaaacgcaacgaattttcaagcag
tactttggttgtgagcaagatgttgagttcaccacttatttttcagaaagcccattggca
agaacacactacattgtacgtgttgataataacaatatggatgtcgatgtaaaaacggta
gagcagaatttaatggaagcatcatcaacttgggatgatcgtttatcagatgcgatcgta
gcaaactttggagagagtaaaggactgccattatcgaaagaatacatgcgtgcattccct
cgttcttacaaagaagacatgatgccgggttcagcggtggatgatatccagcgattggaa
gccttagatgaagagcacaaactcggcatgttgttctatcgtccacaagaagaagcggcc
gattcaaaagcggtgcgcttaaaactctaccaccgcgacgagccaatccatctttctgat
gtgatgccaatgttggaaaacttagggctgagggtgatcggagagtcaccttatgaagta
cgcaagttaaatggacaaacgtattggatcttagatttctcaatgctgcataagagcgat
aagagtgtcgatcttcgagaagcgagagatcgttttcaacaagcatttgcggctatttgg
gctggtgaattagagagtgatggcttcaaccgactagtactcggtgcttcattaactggg
cgcgaagtctcgattcttcgtgcttatgcgcgttacatgcgccaagtgggtttcccattc
agtcaacaatatattgaagatacactcagccattatccagatgtagcaaaagggctggtg
gaactattcttaaagcggtttgatcctaaacacaaaggggctcaaaaagggcaaacggat
cttatcaacgctattactgaagagttagatcgtgttgatagcttggatgatgatcgtatt
attcgtcgttatatggagatgatcagtgcaacgatccgtactaactacttccagctggat
gaaaacaatcagatcaaaccttggctttctttaaaaatgaaaccgaaagagatttctgaa
attccagctcctgtgccggctttcgaaatcttcgtttatgcgcctgatattgaaggtgtt
catttacgtggtggtaaagtagcacgtggcggattacgttggtctgatcgccaagaagat
ttccgtaccgagattctagggttagtgaaagcgcaacaggtaaaaaatactgttattgtt
cctgtgggagcaaaaggtggttttgtgtgtaagaaacagcacatgtttaccacgcgtgat
gagatctttgccgagggacaacgctgctataaacgttttattcgtgcattactcgatgtt
tccgacaatattattgaaggcgaagtcgttccacctaaaaatgtcgttcgtcatgatgaa
gatgacccttacttagttgtagccgcggataaagggacagcaacattttccgatttggct
aactcagtgtcagcagaatacaatttctggctaggtgacgcttttgcttctggtggttca
aatggttacgaccataaagccatggggattacagcaaaagggggatgggagtcagtcaag
cgccacttccgtgaaatgggcattaactgccaaaccacagatttcacagcgattggcatc
ggcgatatggctggagatgtgttcggtaatggtatgctgctgtctaaacacatctgtttg
caagcagcgtttaaccatttgcatattttcatcgatccaacaccaaattcagcaaaaagt
tgggaagagcgcaatcgcttattcaacacgccacgatctagctgggaagattacaacgca
aagttgatctcaaaaggtggtggtatcttctctcgcaaagcgaaatcgatcaccttaacg
cctgaaattcaaaaaatgatcggcactaagaaggcttctgttgcgcctaatgagctgatt
aaaatgatcttgaaaatggaagtggatcttctgtggaacggcggcatcggcacctatgtt
aaatcatcgaaagagagccattctgatgtaggtgaccgtggtaacgatgctctaagaatt
gatggacgcgatcttcgcacaaaagtgatcggtgaaggtggtaacttaggtatgactcaa
cttggacgtgttgagtatgcattaactggtggtcgtgttaataccgactttgttgataac
gttggcggcgtcgattgctcggataatgaagttaatattaagatcttcttgaatggcttg
gtggcgaatggtgatcttaccgtcaaacaacgtaatcagatcttagagtcgatggaagac
gaagtaggaggcatcgttattgaagatgcttacgctcaatctgaagctatttctgtcact
gagcaacagggtgtatcgttagttaaagagcagattcgtttcatccatgctatggaaaaa
gcagggcaccttgaccgagcattggaatacattccagatgatgaaactttgcttgagcgt
gagaagcagggatttgcattaacccgtccggagctatcggtattagtggcatacggcaaa
atggtgttgaaagaggaattggcttgtgaagagatttctcacgatgaattccattcacag
cagttgatcaactatttccctactgagttacgtcgtaactattctcagcacatgcaacag
catccacttcgtgcagagatcattgctacggctctggccaaccagatggtgaacgaaatg
ggatgtaatttcgtgacccgtctgcaagaagaaactggtgcgaatgttgtcgatattgcc
aatgcttacacggcggcaagagaaatctatggtttaggccgtgttcttgagcaggttcgt
ttactcgacaataaagcagaagccgatgcacagtacgatgtgattttcttagtacgccga
accttacgccgcttatctcgttggttgctgcgtaatcgttcaggcaaacaatcggtcaaa
gatttgattgcgctttatcaaactgacgtcaatgccgtttccgctgaactagataatatg
ctcgttgctgaagaggttgcagagcataatgccatggctcaagtctggattgataaaggc
attaactcagaactggcgaattacgttgctcgtttatcaagcctgtactcagcactggat
atatccacagtggcacgtgataaaggtaagactgttgctcagacagctaagctttacttt
aacttaggtgatcgtttatcactgcactggttcttaaaacagattaacggtcaagcggtg
gataacaactggcaagcactagctcgcgctgcattccgtgaagatttagactggcagcag
cgtcaactcactgcgcaagtattgaattgtacttgtgcaccagaagaactcgatgtaatg
aaagcactggatgaatggattgctagtaatgaagtgtccttaatgcgctgggagagtatc
ctcaacgaatttaaagttggtgcagtacatgaatttgcaaaattctcagtagcattaaga
gaattagtacttttaaatttgaattgtgcggcaaatgagtaa

DBGET integrated database retrieval system