KEGG   Vibrio anguillarum M3: N175_16680Help
Entry
N175_16680        CDS       T02823                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lag  Vibrio anguillarum M3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    N175_16680
Enzymes [BR:lag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     N175_16680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(462347..463285)
Genome map
AA seq 312 aa AA seqDB search
MNKGQIMNQLVVLGSVNADHVLQVPSFPRPGETLHGRHYQVIPGGKGANQAVAAARLKAD
IGFIACVGDDAFGINIRENFKLDGINIAGVKMQPNCPTGIAMIQVSDNGENSICISAEAN
DKLTADAIEPDLAAIGAAKYLLMQLETPIDGIIKAAQIAKQNRTNVILNPAPARDLPDTL
LECVDVITPNETEAQRLTGITVDDDHTAQLAANELHKKGIEIVLITLGAKGVWLSQNGRG
QLIAGFKVDVTDTTAAGDTFNGALVTGLLEDMPLESAIKFAHAAAAISVTRFGAQTSIPT
RVEVDAFLALHQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaggacaaattatgaatcagttagtggtattaggtagtgttaacgctgaccat
gttttgcaagtgccttcatttcctcgcccgggcgagacgctgcatggtcgtcattatcaa
gttattcccggtggtaaaggggccaaccaagctgtagcggctgcgcgattaaaagcggac
attggttttattgcctgcgtgggtgacgacgcattcggtatcaatattcgtgagaatttt
aagctcgatggtatcaacattgcgggagttaaaatgcagcccaattgtccgacgggcatt
gcgatgatccaagtctcggacaacggagaaaacagcatctgtatttcggcagaggcgaat
gacaagctgacggctgatgccattgaaccggatttagccgccattggtgcggccaaatat
ttattgatgcaattagagacgccaatcgatggcattattaaagctgcgcaaatcgccaaa
caaaatcgtaccaatgtgattttaaacccagcgcctgcccgagatctgcctgatactctg
ctagaatgtgtcgatgtgatcacaccaaacgaaacggaagcgcagcgcttaacggggatc
acggttgatgatgatcacacggcgcaattagcggccaatgaactgcataaaaaagggatt
gaaatcgtcttgatcaccttaggtgcaaaaggcgtttggctaagccaaaatgggcgtggt
caactgattgctggttttaaagtcgatgtgacagacaccaccgcggcaggtgatacgttt
aacggtgctttggtcacgggtttgttggaagatatgcctttagaatcagccattaaattt
gcgcatgctgcggcagccatttctgttacccgttttggtgcgcaaacctcaatacccacc
cgagtcgaagtggacgcgtttctcgctctgcatcaatag

DBGET integrated database retrieval system