KEGG   Vibrio anguillarum M3: N175_18615Help
Entry
N175_18615        CDS       T02823                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lag  Vibrio anguillarum M3
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lag00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    N175_18615
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    N175_18615
Enzymes [BR:lag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     N175_18615
Lipid biosynthesis proteins [BR:lag01004]
 Desaturase
  First
   N175_18615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(921736..922863)
Genome map
AA seq 375 aa AA seqDB search
MESASKPPLIWINIVIFSFSLGLATIAAPLYGWQFGYGMEHWLWLMICFSFCNLSITAGY
HRLWSHKTYEAHWALRLLFALGGAFALQNSALHWSSDHRVHHKHVDNNDKDPYSAKRGFW
FSHIGWMLRHYNKTTYDDYSNCRDLQKDKIVMWQHKYYVPLALAMNLGVPLILGFIYHDI
LGMLLIVGALRLVLNHHTTFFINSLAHIWGSQPYTDKNTARDNGILAFFTFGEGYHNYHH
IFENDYRNGIYWWQYDPTKWLIKLCSWLGLAGKLRTSPPLKVEKAKALMALSHAQKQIAA
LPNQQLVMASIQREFDALVIQLQEYYELKKQLIESKKNNMVRRYEHSLLMLRYRQVKQQL
ALQKSNWQLIVRQYS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaatcggcatcaaaaccaccacttatctggataaacatcgtcatttttagcttcagc
ttgggcttagcgacgattgcagcccctttgtatggatggcaatttggctacggcatggag
cattggctttggctgatgatttgtttttccttttgcaacctttccattaccgcgggatat
caccgtttatggtcacataaaacctatgaagcacattgggcactgcgattattgtttgca
ttaggtggggcatttgcactgcaaaacagtgcactacattggtcttctgatcaccgagtt
catcacaagcatgtagacaataatgacaaagatccttattcagcaaaacgaggtttctgg
ttttcacacataggttggatgctgcgtcactacaataaaaccacgtatgatgactactcc
aactgccgtgatctgcaaaaagataagatcgtcatgtggcagcataagtattatgtgcct
ttggcactcgcaatgaacttgggcgttcctctgatccttggttttatttatcacgatata
ctgggcatgttactgatcgtgggtgcactgcgtttagtgctcaatcatcacacgacattt
ttcatcaattcgctggctcatatatggggtagccaaccttatactgataaaaatacagcc
cgcgataacggtattttggctttcttcacttttggcgagggctaccacaattatcaccat
atttttgaaaacgattatcgtaatgggatttattggtggcaatacgacccaacaaaatgg
ctgatcaagctgtgttcgtggcttgggttggctggtaaactgcgcacttctcctcccctt
aaggtagaaaaagcgaaagcgttaatggcattaagccatgcgcaaaaacagatcgccgcg
ttacccaatcagcaactcgttatggccagcatacaacgtgaatttgacgctttagtcata
cagttgcaagagtattatgaattaaagaaacagctgatcgaaagtaaaaaaaacaatatg
gttcgtagatatgaacactccctattgatgctgcgctatcgacaagtgaagcaacaatta
gcactacaaaaatccaattggcagcttattgtgcgtcagtactcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system