KEGG   Lactobacillus acidophilus 30SC: LAC30SC_00725Help
Entry
LAC30SC_00725     CDS       T01436                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lai00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
148328..150277
Genome map
AA seq 649 aa AA seqDB search
MCGIVAFYDPKINEKQAVIGKMMATIKHRGPSSDGYYTNDEVALGFRRLSIIDLRGGTQP
IYNEDKTRAIIFNGEIYNFKPLREQLIKAGHTFTTKADTEVLLHGYEEWGMDGLLKKVRG
MFAFLIWDDNNKTLYGARDFFGIKPMYYSNQDGHLLVGSELKSFLEYPKFKRELNVEAVK
PYLMNQYNDLEETFFKGVYRFPAGHWFEYKDGEMKTHQYWDAEYKENSLSFEETLKRIND
DLKETVDLYRNADVKVGAFLSEGIDSSYLTTLLNPDDVFSVSFDDSTYDEASKAKALADI
NHWKFFSDKVDADEAMRDFPEMQYHMDEPDANPSIIPLWYLCKLARKHVTVALSGEGADE
LFAGYVNYGMHTHNDLIKVFTSELKKLPKNKQVKLAHKIKKMPNFPGKVHMYTNLAEPSE
FYVGQSVIYDMDYPTIFTSKDANSILQPTYRNKLTVNGIYQKDFKKVKGIDNVKQMQYID
LHHFMLNDIEQKADKISMAHSLEVRVPYLDKKIAELANSIPTKYLVNRHDTKYALRKASE
KVLPDEWAKRPKLGFPTPIKQWLKEPRFYKQVRSLFEEEFVNDIFDQKKIIKLLDDNYEG
DGSHRRQIWAIYTFLVWYKLFFVDYENTVKKYQHVQPEVANLIKQGKLL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcgcattttatgatccaaaaataaacgaaaaacaggccgttattggc
aaaatgatggctacgatcaagcaccgtggacctagttccgacggttactacactaacgat
gaggttgcccttggtttcagaagattgtcaattatcgatcttcgtgggggtacgcaacct
atttataatgaagataaaactagagcaattatctttaatggtgaaatttacaactttaag
ccattaagagaacaattaattaaagcaggccacactttcactaccaaggccgatactgaa
gtattgcttcacggttatgaagaatggggcatggatggtttacttaagaaggtacgtggt
atgtttgctttccttatctgggatgacaacaacaagaccctttatggtgcacgtgacttc
tttggtatcaagccaatgtactacagcaaccaagatggccacttgcttgttggttcagaa
cttaagagtttcttggaatatccaaagttcaagcgtgaattgaacgttgaagctgttaag
ccatacctcatgaaccaatacaacgaccttgaagaaactttctttaagggtgtttacaga
ttcccagcaggtcactggttcgaatacaaagatggcgaaatgaagacccaccaatactgg
gatgctgaatacaaggaaaacagcttaagctttgaagaaactttgaagcgcatcaacgat
gacttgaaggaaactgttgacttgtacagaaacgccgacgttaaggttggtgccttcttg
tcagaaggtatcgactcttcatacttgaccactttgcttaacccagacgacgttttctca
gtaagttttgacgactcaacttacgatgaagcttcaaaggctaaggctttagctgacatc
aaccactggaagttcttcagtgacaaggttgacgccgatgaagctatgcgtgatttccca
gaaatgcaataccacatggatgaacctgatgccaacccatcaatcatcccactttggtac
ttgtgtaagttggctcgtaagcacgttactgttgcgctttctggtgaaggtgccgacgaa
ttgtttgccggttatgttaactacgggatgcacacccataatgatttgatcaaggtcttc
actagcgaacttaagaagttgcctaagaataagcaagttaagttggcccacaagattaag
aagatgcctaacttcccaggtaaagttcacatgtacaccaatttggctgaaccaagtgaa
ttctacgttggtcaatcagtaatttacgacatggattacccaactatctttacctcaaag
gatgccaacagcattttgcagccaacttaccgcaacaagttgactgttaacggcatttac
caaaaggacttcaagaaggttaagggcatcgacaacgttaagcaaatgcaatacatcgat
ttgcaccacttcatgcttaacgatattgaacaaaaggccgacaagatctcaatggctcac
tcacttgaagttcgtgtgccatatcttgataagaagatcgcagaattagctaactcaatc
ccaactaagtacttggtaaaccgtcatgataccaagtacgcacttcgtaaggcttcagaa
aaggtattgcctgacgaatgggctaagcgtccaaagcttggtttcccaacaccaatcaaa
caatggcttaaggaaccacgcttctacaagcaagtacgcagcttgttcgaagaagaattc
gtaaatgatatcttcgatcaaaagaagataattaagcttcttgatgacaactacgaaggc
gatggctcacacagaagacaaatctgggctatctacaccttccttgtttggtacaagttg
ttcttcgtagattacgaaaacactgttaagaagtaccaacatgttcaacctgaagttgct
aatttgattaagcaaggtaagttactttaa

DBGET integrated database retrieval system