KEGG   Lactobacillus acidophilus 30SC: LAC30SC_01885Help
Entry
LAC30SC_01885     CDS       T01436                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lai03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369663..370262
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIAHLIDAYMKLPGIGEKTATRLAFYTMDMPQEDVEDFARALIQVKKDIHQCPIC
GNITEKDICDICSNPNRDQTTIMVVEQPKDVMSFEEMGEYSGLYHVLHGVLSPMDGIGPE
EINIKSLITRLQKHDEVKEVILALNSTSEGESTAMYISKLIKPAGIKVTRLAAGLSVGSD
IEYANSITLKRAVQGRTTL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatatccattaccaatagctcatttaattgatgcttatatgaaacttccaggcatt
ggtgaaaagaccgccactagattggctttttacacaatggatatgccgcaagaagatgtg
gaagattttgctagagcattaattcaagtgaaaaaagatatccatcaatgtccaatttgt
ggcaatattaccgaaaaagatatctgtgatatttgttctaaccctaatcgtgatcaaaca
acgattatggtggttgaacagcctaaagatgtaatgtcttttgaagagatgggtgaatac
agcggtttgtatcatgtgcttcacggcgtattatcaccaatggatggaattggtccagaa
gaaatcaacattaaatctttaattactcgtttgcaaaagcatgacgaagttaaagaagtg
attttagctcttaattcgacttctgagggtgaatcaaccgcaatgtacatcagcaaattg
atcaaaccagctggtattaaagttactcgcttagctgcaggtttatctgtaggtagcgat
attgaatatgccaattcaattactttgaaacgggcagtacaaggaagaacgactctataa

DBGET integrated database retrieval system