KEGG   Lactobacillus acidophilus 30SC: LAC30SC_02040Help
Entry
LAC30SC_02040     CDS       T01436                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lai00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lai00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397369..399123
Genome map
AA seq 584 aa AA seqDB search
MNLFKKAVISTVAGMTLAGCLGGITSQVDAAKGHKTRVTRVTEKQINNYIKKASLKQKIG
QMYVSRTPQQPGVAEHDAYKYNLGGFIVYDADLQNYTTNQFKTKMASYQNAERIPLLIGI
DQEGGLVSRLTHSGLIPQNGDQFKFARDQYENAEKTQKGSGMKAVTKYAHDTATLLRSLG
VNWNYAPDADYSDNPKSFIYQRGFGGVMGKQSYQGEANYISQVIPAWQHDNLIAATLKHF
PGYGDAADTHTGFAHTDKSKADIESKDMLSFKAGIKAGADSVMVTHVIYDDIDPEYPASL
SKKINTLLRKDCNFKGVIVTDALEMGAIKDFAKQHGNAPVDVLAVKAGNDMIMTTDYATG
IPEIAAAVKKGEISKTQINNSVRRILNMKNKLHLLKPSSLSLKKQNKRIFTLKDVAYNRK
DKATVIAGTAKKGTHLSLKNTDTKKVVKKIKVGKSGNFKITLSVKEDPQNFALVGKGYVS
VNVHVQSDKVAFPVLRKFTLNAVTYNSDHRIATISGKIPDAGEEGSLTMSFLNAATNKAV
GSAVVGKDGNFSSTVRVLDKDQQIKVVAQNNKDYEAQTVTVKAK
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatttaaaaaagccgttatttctacggtcgcaggtatgactcttgcaggctgc
ttgggcggaattacctctcaagttgacgccgcaaaaggtcataaaactcgtgttactaga
gtgacagaaaaacaaatcaataattacattaagaaggctagtctcaagcaaaagattggt
caaatgtatgtttcaagaacaccgcaacaacccggtgttgctgaacatgatgcctataaa
tataacttaggtggtttcattgtatatgatgctgacttgcaaaattatacgaccaatcaa
tttaagactaagatggcaagctaccaaaatgcagagagaattcctcttttaatcggaatc
gaccaagaaggtggccttgtttctagattgactcacagtggtttgattccacaaaatggt
gatcaatttaagttcgcacgtgatcaatatgaaaatgcagaaaagactcaaaagggcagt
ggtatgaaagctgtaaccaagtatgctcatgatactgcaactttattgcgtagcttaggc
gtcaactggaattatgctccagatgctgactatagtgacaatccaaaatcatttatttat
caacgtggttttggtggcgtaatgggcaagcaaagttatcaaggtgaagcaaattatatt
agtcaagtaattcctgcttggcaacatgataatttaattgcggcaactttgaagcacttc
ccaggctacggcgatgctgctgatactcacaccggttttgcacacactgataaatcaaaa
gctgatattgaaagcaaagatatgttgtcattcaaagctggtattaaggctggtgctgat
tcagtcatggttactcacgtaatttatgacgatattgacccagagtatcctgcttcactt
tctaaaaagataaacaccttgttgagaaaagattgtaatttcaagggcgtgattgttact
gatgcccttgaaatgggtgcgattaaagattttgctaagcaacatggcaatgctccagtt
gatgttttagcagttaaggccggtaatgacatgatcatgacgactgactatgctactggt
attccagaaattgcagctgccgttaagaagggtgaaatttctaagactcaaatcaataat
tccgtaagaagaattttgaacatgaagaataaacttcacttgttgaagccttcatcatta
agtcttaagaagcaaaacaagagaatctttactcttaaagatgttgcttacaacagaaaa
gataaagctactgtaatagctggcacagctaagaaggggactcaccttagccttaagaat
actgatactaagaaagttgtaaagaagattaaggttggtaagagtggcaacttcaagatt
actttgtcagttaaggaagatccacaaaactttgctttagttggcaaaggatatgtcagt
gtaaatgttcacgttcaatcagataaggttgcattcccagttttgaggaaatttactttg
aacgcagtaacttacaattccgaccatagaattgcaactatctctggtaagattcctgat
gctggtgaagaaggatcattgacaatgtcattccttaacgccgcaactaataaagctgtt
ggttcagctgttgtaggtaaggatggtaacttctcatcaactgtaagagttcttgataaa
gatcagcaaatcaaggttgttgctcagaataataaagattatgaagctcaaacagtaact
gttaaagcaaaatag

DBGET integrated database retrieval system