KEGG   Lactobacillus acidophilus 30SC: LAC30SC_02385Help
Entry
LAC30SC_02385     CDS       T01436                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LAC30SC_02385
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAC30SC_02385
   00620 Pyruvate metabolism
    LAC30SC_02385
   00650 Butanoate metabolism
    LAC30SC_02385
  Lipid metabolism
   00071 Fatty acid degradation
    LAC30SC_02385
  Amino acid metabolism
   00350 Tyrosine metabolism
    LAC30SC_02385
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LAC30SC_02385
   00626 Naphthalene degradation
    LAC30SC_02385
Enzymes [BR:lai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LAC30SC_02385
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LAC30SC_02385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484385..487012
Genome map
AA seq 875 aa AA seqDB search
MAKTQQKQTLTEEEKKKQIYDMVDNLVKKSHVALDQMANFTQEQVDKICEAVATAGEQNA
YPLAKMAVEETKRGVVEDKTTKNMYASENIWNSLRHEKTVGVIEEDKELGLTKIAEPKGV
IAGVTPVTNPTSTVIFKAMLALKTRNTIIFGFHPQAQKCCVETGKIIRAAAVAAGAPADA
VQWIEEPSLDATTDLMNNPGVQTILATGGPGMVKAAYSSGKPAIGVGPGNGPSYIEKSAN
IDRAVYDIVLSKNFDNGMVCASENSVVVDDEIYDKVVDEFKKWDCYFLNKEEIKKFEEHF
IDPRRGTVAGPVAGKSAYEIAKLCGVDVPKNTKVIVAEYNGVGRKFPLSAEKLSPVFTLY
RAKNHDDAFRICSELLDYGGRGHTAGLHSSDKKIIDEFAMKMDACRILVNSPAALGGIGD
LYNNMLPSLTLGTGSYGANTFSHNIGAKDLLNIKTVAMRRDNMQWVKVPSKTYFEHNAAN
YLRHMPNVNRFFIVTDEGVADEGFADEITDIISKRRGQKEYEVFKAVTLDPNTDVIKDGV
HRMNIFKPDVVIAIGGGSVMDAAKAMRLFYENPEMSFEEAYQKFLDIRKRVVRFPKINGV
QLVCIPTTSGTGSEVSPIAIISDAKTGIKHTLCDYALTPDVSIVDDQFVQTLPKRLIAWS
GFEALGHAIESYVSTMATDFTRGWSLEAIKIIFANLKNSYDGNLAARKQMHDAATIAGMA
YSNAFLGLEHSIAHTVGSTFDIPSGVSDAIALPQVIRFNSKRPEKLAMWPHYSVYRADTD
YADIAKAIGLTGSSKEELIEGLVQKIIDLAESVGIKMAYKGYGVDKAEFDKKVDELAVEA
YGDQNTVTNPTAPLISQIIQLMKDCYEGKGIVNNK
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacacaacaaaaacagactcttacagaggaagaaaagaaaaagcaaatctac
gacatggtagataacttagtaaagaaatcacatgttgcattagaccaaatggctaacttc
acacaagaacaagttgataagatctgtgaagcagttgctactgccggtgaacaaaatgct
tatccattggctaaaatggccgttgaagaaactaagcgtggtgtggtagaagacaaaact
actaagaatatgtacgctagtgaaaatatttggaatagtttacgtcacgaaaagactgtt
ggcgtaattgaggaagacaaggaattaggtttaaccaagattgctgaacctaagggtgtc
attgctggtgttactccagtaactaacccaacttcaactgttatttttaaagctatgctt
gctttaaagactagaaatacaattatcttcggcttccacccacaagctcaaaagtgttgt
gtagaaactggtaagattattcgtgctgctgctgttgccgctggtgctccagcagacgca
gttcaatggattgaagaaccaagtttagatgctactactgatttaatgaataacccaggc
gttcaaactattttggctactggtggtccagggatggttaaggctgcttattcatcaggt
aagccagctattggtgttggtcctggtaacggtccatcttacattgaaaagtcagctaac
attgaccgtgctgtttatgacattgttttgtcaaagaacttcgataatggtatggtttgt
gcttctgaaaattcagttgttgtagacgacgaaatttacgacaaggttgttgatgaattc
aagaagtgggactgctacttcttaaacaaagaagaaattaagaagttcgaagaacacttc
atcgacccaagacgtggtactgttgcaggtcctgtagctggtaagtcagcttacgaaatt
gctaagctttgtggtgttgatgtaccaaaaaacaccaaggtaatcgttgctgaatacaac
ggtgttggtagaaagttcccactttcagctgaaaagctttcaccagtattcactttgtac
cgtgctaagaaccatgacgatgccttcagaatttgttctgaacttcttgattacggtggt
cgtggtcacaccgctggtcttcactcaagcgacaagaagatcattgatgaatttgcaatg
aagatggatgcttgccgtatcttggttaactcaccagctgccctcggtggtatcggtgac
ctttacaacaacatgttgccatcacttactttaggtactggttcttacggtgccaacacc
ttctcacacaacattggtgctaaggacttgcttaacatcaaaacagttgctatgcgtcgc
gacaacatgcaatgggtaaaggttccttctaagacctacttcgaacacaacgcagctaac
tacttacgtcacatgccaaacgtaaatcgtttcttcatcgttactgatgaaggtgttgct
gatgaaggctttgctgatgaaattactgacatcatttcaaagcgccgtggccaaaaggaa
tacgaagtattcaaggctgtaactcttgatcctaacactgacgtaattaaagacggtgtt
cacagaatgaacatcttcaagccagacgttgtgattgctatcggtggtggttcagtaatg
gacgctgctaaggcaatgcgtttgttctacgaaaacccagaaatgagttttgaggaagct
taccaaaagtttttggacatcagaaaaagagtagttcgcttcccaaagattaacggcgtt
caacttgtatgtatcccaactacttcaggtactggttcagaagtttcaccaattgctatc
attagcgatgctaagactggtattaagcacactttatgtgattatgctttaactccagat
gtttcaattgttgatgaccaattcgtacaaactttaccaaagcgtttgatcgcttggtca
ggttttgaagcattaggccacgcaattgaaagttatgtttcaacaatggctactgacttt
actcgtggttggtcacttgaagctattaaaatcatttttgccaacttaaagaactcttac
gatggtaatcttgctgctcgtaagcaaatgcacgatgccgctactattgcaggtatggct
tactcaaacgcattccttggtttggaacactcaattgctcatactgtaggttcaaccttt
gatattccaagtggtgtaagtgatgctattgctttaccacaagttatccgcttcaattct
aagcgtccagaaaagcttgctatgtggcctcattactctgtttaccgtgctgatacagat
tatgcagatattgctaaggccattggcttgactggttcaagcaaggaagaattgattgaa
ggattagttcaaaagatcatcgacttggctgaatcagttggcatcaagatggcttacaag
ggctacggtgttgacaaggctgaattcgacaagaaagttgacgaattagctgttgaagca
tacggtgaccaaaacactgtaactaacccaactgctccacttattagccaaatcattcaa
ttaatgaaagattgctacgaaggcaagggtattgttaataacaaataa

DBGET integrated database retrieval system