KEGG   Lactobacillus acidophilus 30SC: LAC30SC_02990Help
Entry
LAC30SC_02990     CDS       T01436                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LAC30SC_02990
Enzymes [BR:lai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LAC30SC_02990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617861..618787
Genome map
AA seq 308 aa AA seqDB search
MKKIVVIGSSNVDTTLHVKDFPKPGETINATDVTTAGGGKGANQAIAAAKSGAETYFINR
VGEDSDGGYITHQLKSYGVDTTYVQTTMGAKTGHAYITLNEAGQNDIIIDHGANYELTVE
DLKAASDLINNWDCIIAQFETPIDVTTSAFKMAKKAGKVTILNPAPAIDKIPADLLKYTD
IIMPNETESAKITGIPIKDNSTLATNAEKLHLLGVKNVIITYGDKGAYISTPDVETLVPA
YKVDATDTTGAGDTFIGYFASNLNADMSNFEEAAKIASRASSIAVQRLGAQPSIPTEQEV
KQAMEDEE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgtagttattggatcaagcaatgttgataccacattgcacgtaaaggat
ttcccaaaacctggtgaaacgattaatgccacagatgttactactgctggtggtggtaag
ggtgctaaccaagccattgctgcagctaagagtggcgcagagacttactttattaaccgt
gtaggtgaagacagcgatggtggctacattacccaccaattgaagagctacggtgtcgac
accacttatgttcaaaccacgatgggtgccaagactggccatgcttacattactttaaat
gaagctggtcaaaacgatattattatcgaccacggtgccaactatgaattgaccgttgaa
gatcttaaggccgctagcgatttgattaataattgggactgcattattgctcaatttgaa
acgccaattgatgttactacttcagctttcaagatggctaaaaaggcaggcaaggttact
attttgaatcctgctcctgcaattgataagattccagcagacttattgaaatatactgat
atcatcatgcccaatgaaactgaaagtgctaagatcacaggtattccaattaaagataat
tctactttggctactaacgctgaaaaattgcacttgcttggcgtaaagaacgtcattatt
acttatggtgataaaggtgcatatatttctacaccagatgttgaaacattagtaccggct
tacaaggtagatgctaccgatactactggtgccggtgacacctttatcggttactttgca
agtaacttgaatgccgatatgtctaactttgaagaagctgctaagattgctagccgtgct
tcatcaattgctgtgcaacgtttgggtgcacaaccatcaattcctactgaacaagaagta
aagcaagcaatggaggatgaggaataa

DBGET integrated database retrieval system