KEGG   Lactobacillus acidophilus 30SC: LAC30SC_03400Help
Entry
LAC30SC_03400     CDS       T01436                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lai00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703893..705800
Genome map
AA seq 635 aa AA seqDB search
MGKMVKVKQRIEDFASGHELKLQEILGCHRKDSGYVFRVWAPNAQAVWLVGDFNDWNKTL
AMQLTSNGVWQIKTDLPQTGQLYKFLVKQADGREVMKMDPMAVELEPRPGNAAVVTELPD
KSWHDGAWLGRNKRSNHFARPINIYEVHASSWKRHEDGSLYTLRDLQRELIPYVKKQGFN
YIEFLPLTAHPLDASWGYQTIGYYALERTYGTPQELQDFVEACHQENIGVLSDWVPGHFC
INDDALAYYDGTPCYEFSEKWRAENKGWGALNFDLGKPEVQSFLLSSALFWLEFYHLDGL
RVDAVSNMIYRDYDRGPGEWKPDKYGGNRNLEGMEFLRRLNRTIKGLHPECLMIAEESSA
QVKITGRIEDGGLGFDFKWNMGWMNDILNFYQMDPLFRKYHFNLTTFSFMYRMSENFILP
LSHDEVVHGKRSLMNKMFGPRDKQFAQLRNLLTLQMTYPGKKLLFMGSEFGQYLEWRYNE
ALDWAELNDELNSKMQYFDQKLNEFYLNEPSLWQLEQKDESVQIIDADNKDESVLTFIRQ
GKIRHDFVIVILNFTPVERKHFSIGVPYSGKYQEAFNTARKEFGGTWDKDVQTMTTKQEK
FKNLDYQIELDLPGFSAMILKPLDAHIKRRNRRKK
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagatggtgaaagttaaacaacgaattgaggattttgcttcgggtcatgagcta
aaattgcaagaaattttaggttgccatcgtaaagatagcggctatgtttttagagtttgg
gctcctaatgcacaagcagtatggctagtaggcgatttcaatgattggaataagacactg
gcgatgcagctcacgagtaatggagtttggcaaataaaaactgatctgccacagactggg
caactgtataaatttttggttaaacaggctgatggccgtgaagtcatgaaaatggatccg
atggcagtagaacttgaaccacgtccaggcaatgcggcagtagttactgaattacctgac
aaaagctggcatgatggggcctggctgggacgcaataaacgctctaaccactttgcacgt
ccaatcaatatctatgaagtacatgctagttcgtggaaaagacatgaggatggttctctt
tacaccttgagagatttgcagcgagaattaattccttatgtgaaaaagcagggattcaat
tatattgaatttttgccgctgacagcgcatccccttgatgcatcttggggctaccagact
attggctattatgcattggagcgtacttatggaacgccacaagagctgcaagactttgtg
gaggcatgccatcaggaaaatattggcgtgttgtcagattgggtacctggacatttttgc
atcaatgatgatgcattagcttattatgatggaacaccatgctatgaatttagtgaaaaa
tggcgtgcagaaaataaaggttggggcgcattgaattttgatttgggcaaaccagaagtt
caatcgtttttactttcaagtgcgctattttggcttgaattttatcaccttgatggtttg
agagtagatgccgtttccaatatgatttaccgcgattatgatcgtggacctggtgaatgg
aagccggataaatatggtggcaaccgcaacttggaaggaatggaatttttacgcagactt
aatcgcaccattaaaggattgcaccctgagtgcttgatgattgcggaagaaagttctgct
caagtaaaaattaccggtcgaattgaagatggtggcttaggctttgactttaagtggaat
atgggctggatgaacgatattctgaacttttatcaaatggacccactatttagaaaatac
cactttaatttgacgacattttcatttatgtatcggatgagcgaaaactttattttacct
ttatcacatgatgaagtagttcacggcaaacgtagcttaatgaataaaatgtttgggcca
agggataaacaatttgcacaactgcgaaatttattgacgctgcaaatgacttatccaggt
aaaaaactactctttatgggtagtgaatttggtcagtatttggaatggcgctataacgaa
gcgctcgattgggccgaattaaatgatgagcttaattctaaaatgcaatattttgatcaa
aagctgaacgaattttacttaaatgagccatcattatggcaattagagcaaaaagatgag
tctgtacaaattattgatgcagacaataaagacgaatcggttttaacatttattcgtcaa
gggaaaattagacatgattttgtcatcgttattttgaactttacgcccgtagaaagaaaa
cacttttcaattggtgtgccatattctggcaagtatcaagaagcatttaatactgctaga
aaagaatttggcggcacctgggataaagacgttcagactatgacgaccaagcaagagaaa
tttaagaatctggattatcagattgagctagatttgcctggctttagcgcaatgatttta
aaaccactcgatgctcacatcaaaagaagaaatagaagaaagaaatag

DBGET integrated database retrieval system