KEGG   Lactobacillus acidophilus 30SC: LAC30SC_03500Help
Entry
LAC30SC_03500     CDS       T01436                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAC30SC_03500 (tpiA)
   01230 Biosynthesis of amino acids
    LAC30SC_03500 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAC30SC_03500 (tpiA)
   00051 Fructose and mannose metabolism
    LAC30SC_03500 (tpiA)
   00562 Inositol phosphate metabolism
    LAC30SC_03500 (tpiA)
Enzymes [BR:lai01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LAC30SC_03500 (tpiA)
Exosome [BR:lai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LAC30SC_03500 (tpiA)
  Exosomal proteins of bladder cancer cells
   LAC30SC_03500 (tpiA)
  Exosomal proteins of melanoma cells
   LAC30SC_03500 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
733133..733891
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLHMNPEQTTEFVDAVKDKLPDPSKVESLICAPAVDLDALRKAAKGSNL
HIGAENCYFEDEGAYTGETSPKVLKEMGMDYVIIGHSERRGYFHETDEDINKKAKAIFAN
GLKPIICCGESLETREANKQEDWVVAQIKAALDGLTAEQVSSLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLK
PESYLELVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtacaccaattattgctggtaactggaaattacacatgaacccagaacaaact
actgagttcgttgacgcagttaaggacaagttaccagatccaagtaaggtagaatcactt
atttgtgcacctgcagttgaccttgatgctttgagaaaagctgctaagggttcaaacttg
cacatcggtgcagaaaactgctactttgaagacgaaggtgcttacactggtgaaacttca
cctaaggtcctcaaagaaatgggtatggactacgtaattattggtcactcagaacgtcgt
ggctacttccacgaaactgatgaagacattaacaagaaggccaaggcaatctttgctaat
ggcttgaagccaattatttgctgtggtgaatcacttgaaactcgtgaagctaacaagcaa
gaagactgggtagttgctcaaattaaggctgctttagatggtcttactgctgaacaagta
tcttcacttgtaattgcttatgaaccaatctgggctattggtactggcaagactgcttca
tcagaccaagctgaagaaatgtgcaagactattcgtgaaactgtaaaggacttgtacaac
gaagaaactgcagaaaacgttcgtattcaatacggtggttctgtaaagccagctaacgtt
aaggaattaatgtcaaagcctgacattgacggtggcttagttggtggtgcttcacttaag
cctgaatcatacttagaattggtaaactaccaagactaa

DBGET integrated database retrieval system