KEGG   Lactobacillus acidophilus 30SC: LAC30SC_03785Help
Entry
LAC30SC_03785     CDS       T01436                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lai00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lai00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(786885..788189)
Genome map
AA seq 434 aa AA seqDB search
MSFKSGVAKVAGKSSYWFLHNVMKGGTSFPGKLAMKIDPNVLNSLAKGYETVIVTGTNGK
TMTTALIVEALKKKYGDVLTNPSGSNMQQGIVTAFLAHKHKRVKRKIAVLEVDEANVKMV
TKLLHPSVFVLTNIFRDQMDRYGEIYTTYEKIVNGIKLAPDATIIANGDASIFSSVKLPN
KKIFYGFKLPDDKPENDFKAAVNTDGVLCPKCDHILHYHERIYANLGDFFCPNCGYHRPD
LTFTVNKIIEQTPNSLKFQMGNKDYSINIGGTYNIYNALAAYSVARHFGLTEAEVAQAFA
ENKRIFGRQELIHYGGKDIDLILVKNPVGLDEVLHMLNTEKDDYSLVALLNANHADGIDT
SWIWDADFEGLDCSKIKKVLVGGQRWHDMGFRLEIAGFDPGAMNINPDDDSLIEEIKKLG
FWFLDVWVRAPISQ
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaatcaggagtcgctaaagtcgccggaaaatctagttactggtttttgcat
aacgtcatgaaaggcggtactagttttcctggaaaattagcgatgaaaatcgatccaaac
gtgctgaattctttagctaaaggctatgaaaccgtcattgttactggtactaatggcaag
accatgaccacagctttgatcgttgaagccttgaagaaaaaatatggtgatgttttaacc
aacccatctggttccaacatgcaacaaggaatcgtcacagcatttttagcacataagcac
aaacgcgttaagcgcaagattgctgtacttgaagtagacgaagcaaacgttaagatggta
accaagctgcttcaccctagcgtctttgttttgaccaatattttccgtgatcaaatggac
cgttatggtgaaatttatactacttatgaaaagatcgtaaatgggattaagttagcacca
gatgcaacaattattgctaacggtgatgccagcatcttttcatcagttaagttgcctaac
aaaaagattttctatggtttcaagttgcctgatgacaagccagaaaatgactttaaggca
gctgttaacacagatggtgtgctttgtcctaaatgcgatcacatcttgcactaccatgaa
agaatttacgctaacttaggcgatttcttctgccctaactgtggctaccatcgtcctgat
ttaacctttacagttaacaagattattgagcaaacgcctaacagcctaaagttccaaatg
ggcaacaaagactactcaatcaacatcggtggtacttacaacatctacaatgctttagct
gcttactcagttgctcgtcactttggtttgactgaagctgaggttgcacaagcctttgca
gaaaacaagcgtatcttcggtcgtcaagaattaatccactatggtggtaaagacatcgac
ttgatcttagttaaaaaccctgttggtcttgatgaagttttgcatatgcttaataccgaa
aaagatgactactcattagtcgctttacttaatgccaaccatgcggatggtattgatact
tcttggatttgggatgctgatttcgaaggattagattgtagcaagatcaagaaagtactt
gttggtggtcaacgttggcacgacatgggctttagacttgaaattgctggatttgatcct
ggtgcaatgaacatcaatcctgacgatgacagcttgattgaagaaattaagaaattagga
ttctggttcctggatgtttgggttcgagccccaatatcccaataa

DBGET integrated database retrieval system