KEGG   Lactobacillus acidophilus 30SC: LAC30SC_04440Help
Entry
LAC30SC_04440     CDS       T01436                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lai00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(904226..905707)
Genome map
AA seq 493 aa AA seqDB search
MAFNKEFTWGGATAANQYEGGYDEGGKGLNAVDVLTNGSATEPRKVTWKKPNGETGATPL
VWGQDFKLPDGAVPTMLDGYYYPSHQGTDFYHHYKEDIKLMAEMGFDVFRLSMNWSRILP
NGDDDKPNKEGLAFYDKVFDECAKYGIQPLVTLSHYETPLSLITRFGGWKDRRLIDAFVH
YSDIVMNHYKGKVRYWLTFNEINAMDMAPYMGGGLIDGSEQNRAQGAHNQFVASAKVVKL
AHEIDPNNRVGQMLAYSAYYPYTCDPKDQLKVMEAKQDMLFYSDVQTGGHYPEYRLKKYE
RDGIKLDDTPEDYELIAKYPADFLSFSCYTSNVLTTHETEAKASGNVSAGGVKNPYLESN
AWGWATDPDVLRIALNDLWDRYHKPLWVVENGLGSADILEKDGKVHDDYRINYLRSQIKS
MRDAVTIDGVDLMGYTTWSAIDLVSNGTGEMKKRYGFVYVDRDDRGNGSLKRYPKDSFYW
YKKVISSNGEDLD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaataaagaatttacttggggcggtgctactgccgctaaccaatacgaaggc
ggctacgatgaaggcggcaaaggtttaaacgccgttgatgttttaactaacggttcagca
actgaaccgcgtaaggttacttggaagaagcctaatggagaaaccggtgctactccactt
gtctggggtcaagacttcaaattacctgatggtgcagtaccaacgatgcttgatggttac
tattaccctagccaccaaggaactgacttctaccaccattacaaagaagatatcaaacta
atggcagaaatgggctttgacgtattcagactttcaatgaactggtcaagaattttgcca
aatggcgatgatgacaagcctaataaagaaggattagcattttacgataaagtctttgat
gaatgcgccaaatatggcattcagcctttagttactttatctcactatgaaactcccctt
tctttaattacccgctttggcggatggaaagatcgtcgcttaatcgatgcttttgttcat
tattctgatatcgtgatgaaccactacaagggaaaggttcgttactggcttacctttaac
gaaattaatgcgatggatatggctccatatatgggcggtggcctaattgatggtagtgaa
caaaatcgggctcaaggcgctcacaatcaatttgtagctagtgctaaagtagttaaatta
gctcacgaaattgatcccaacaatcgtgtgggacaaatgttagcctactctgcttactat
ccatacacttgtgatcctaaagatcaacttaaagtaatggaagcaaaacaagatatgctc
ttttacagtgacgttcaaaccggtggacactatccagaatatcgtttgaagaaatatgaa
cgtgacggtattaagcttgacgatacaccagaagattatgaattaatcgctaagtaccct
gctgacttcttaagcttctcctgctacacttcaaatgttttaactactcatgaaactgaa
gctaaagcatctggtaatgttagcgcaggtggcgttaagaacccttaccttgaaagtaat
gcttggggttgggcaactgatccagatgtcttaagaatagctcttaatgacctttgggat
cgttaccacaagcctttatgggtagtcgaaaatggtttaggatctgccgatattttagaa
aaagatggcaaagtccacgatgattaccgcatcaattacttgcgtagtcaaattaaatct
atgcgggatgccgttacaattgatggcgtcgatctaatgggctacactacttggtcagca
attgacctagtatctaacggtactggtgaaatgaaaaaacgctatggttttgtttatgtt
gatcgtgatgatcgcggcaatggatcacttaagcgttaccctaaggattcattctactgg
tacaaaaaagttatttcttccaacggcgaagatttagactaa

DBGET integrated database retrieval system