KEGG   Lactobacillus acidophilus 30SC: LAC30SC_05750Help
Entry
LAC30SC_05750     CDS       T01436                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAC30SC_05750
   01230 Biosynthesis of amino acids
    LAC30SC_05750
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAC30SC_05750
  Energy metabolism
   00680 Methane metabolism
    LAC30SC_05750
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAC30SC_05750
Enzymes [BR:lai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAC30SC_05750
Exosome [BR:lai04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAC30SC_05750
  Exosomal proteins of melanoma cells
   LAC30SC_05750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1140142..1140789
Genome map
AA seq 215 aa AA seqDB search
MRLLVVRHGQSEADILKVCEGLANYSLTKFGHEQAERTAEYIFKNYKVDKIYSSSLKRAV
QTAMHISKKTNIKVIQEDKLQEFNNGLRAGLEYKLAYEKYPNISTAIHESHYQQESELEF
RMRAEYVLSKILSENEPASTIVIVSHGGMIMRLYQAFLKLPVGSNVKLITGDAGIHDWSI
EDGQQFINYSNFPHFYRIKLTPSNIAAEAEAAAKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgattattagtggtcagacatggtcaaagtgaagccgatatattgaaagtatgtgaa
ggtcttgcaaattattctttaacaaaatttggacatgaacaagcagaaagaacagcagag
tatattttcaagaactacaaagtagataagatttattcaagttctttaaaacgagcagtg
caaacagcaatgcacatatcgaagaaaactaatattaaagtcattcaagaagataaattg
caggaatttaataatggcttaagagcggggttagaatataaattagcttacgaaaaatat
cccaatatatcaactgcaatacatgaatcgcactatcagcaagaaagtgaacttgaattt
agaatgagggccgagtatgttctctcaaaaatccttagtgagaatgaacctgcttcaaca
atagtaatagttagtcatggtggaatgattatgcgattatatcaagcttttcttaaacta
ccagtaggatcaaatgttaagttgattaccggggatgctggaattcatgattggtcaatt
gaagatggacaacagtttataaactattctaattttccccatttttatcgaattaaatta
acgccatcaaatatagctgctgaagcagaagctgccgcaaagaagtaa

DBGET integrated database retrieval system