KEGG   Lactobacillus acidophilus 30SC: LAC30SC_06785Help
Entry
LAC30SC_06785     CDS       T01436                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LAC30SC_06785
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAC30SC_06785
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LAC30SC_06785
Enzymes [BR:lai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LAC30SC_06785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1313313..1314812
Genome map
AA seq 499 aa AA seqDB search
MKYRSTRGAKDNALTSPAAIIQGLAQDGGLYVPVDFPKANFQLEDLPKLSYKQISAMIIS
LFFDDFSKDQIKSAVINAYSEQWDDRSIVPIEKHNDNFYMELFHGPTLAFKDIALQMLPQ
LMTRAVQIEKIDRDIIILTATSGDTGTASMRGFANQKGTRVIVFYPEGGVSPVQLKQMLS
QHGDNLEAIAIKGNFDDAQTEVKKIFNDENFRKKLNQNGFQFSSANSMNIGRLVPQISYY
LYTYGQLVRRREINLGDKVNFTVPTGNFGDILAGYYAEKLGLPINKLICASNENNVLTDF
FAKGEYDKRRKFHLTNAPAMDILVSSNLERLLFDLYDKDNEKIASLMNQLTQRGHYQVDK
EVLDKLQTIFAAGFATEDEVKEEIHRVYNYDRYVIDPHTAVGSYVAQQYKSKTNDQTPMV
IVSTASPYKFPETVYEAITGRVCPQTGVAAIKKLHDELGGQLSIGVRTLFDHEPHVEKVI
DPVNMEAAISSILDLKQFI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcgtagtactcgaggcgcaaaagacaatgcgttaacttcaccagccgcaatc
atccaagggttggcccaagatggtggactttatgtaccagtagattttccaaaagctaat
tttcaactagaagatttacctaagttatcttataagcaaatttcagcaatgatcattagc
ttattttttgatgatttttctaaggatcaaattaaatctgcagtaatcaatgcttatagc
gaacaatgggacgaccgcagcattgtgccaattgaaaaacacaacgataatttttacatg
gaactctttcacggtccaactttagcttttaaagatattgctttgcagatgttaccacag
ctaatgacacgtgcagtacaaattgagaaaatcgatcgtgacatcattatcttgactgct
acttctggtgacaccggaactgcttcaatgcgtggctttgctaaccaaaaaggtacacgc
gtcatcgtcttctatcctgaaggcggcgttagccctgtccaacttaaacaaatgctcagt
caacacggcgacaatttggaagccatcgcgatcaagggtaactttgacgatgcgcaaact
gaagtaaagaagatttttaacgatgaaaacttcagaaagaaactaaaccaaaacggtttc
caattctcatctgctaactcaatgaacattggtcgtcttgttcctcaaatttcttattac
ctttacacttatggtcaattggttcgccgtcgtgaaatcaacttgggcgacaaagtaaac
tttaccgtacctacaggcaatttcggcgacattttagctggttactatgcagaaaaactc
ggtttgccaatcaacaaattgatctgtgcttcaaatgaaaacaacgttcttactgacttt
tttgccaaaggtgaatacgacaagcgtcgtaagttccatttaactaacgcaccagcaatg
gatattttagtttcaagcaatctagaacgacttttattcgatttatatgataaagataat
gaaaaaattgctagtctaatgaatcaattaacgcaaagaggtcattaccaagtcgacaaa
gaggtcttagacaaattacaaactatttttgcggctggttttgccactgaagatgaagta
aaagaagaaattcaccgcgtctacaattatgatcgctacgtaattgatcctcatactgca
gtaggttcatacgttgctcagcaatataagagcaagacaaacgatcaaacaccaatggtg
attgtgtctactgctagtccttataagttccctgaaaccgtttatgaggctattacaggt
agagtttgtcctcaaactggcgtagctgccattaagaagttgcatgatgaattgggtggt
caattatccatcggtgtacgcaccttgtttgaccacgaaccacacgttgaaaaagtaatt
gatccagtcaacatggaagcagctatcagttcaattttagatttaaagcaattcatttag

DBGET integrated database retrieval system