KEGG   Lactobacillus acidophilus 30SC: LAC30SC_07700Help
Entry
LAC30SC_07700     CDS       T01436                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
lai00240  Pyrimidine metabolism
lai00250  Alanine, aspartate and glutamate metabolism
lai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LAC30SC_07700 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LAC30SC_07700 (pyrB)
Enzymes [BR:lai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LAC30SC_07700 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Kin17_mid
Motif
Other DBs
NCBI-ProteinID: ADZ07650
UniProt: F0TG06
Position
complement(1494537..1495493)
Genome map
AA seq 318 aa AA seqDB search
MENLNLVSLPHFVSVENLHVDEVEALIKRAEYFKKGGATPRLTKPVYVTNMFFEDSSRTH
TSFEMAERKLGLTVIPFDPAHSSVNKGETLYDTSLIMNALGVDLEVIRHSQNEYYNDLIN
LKDHQHLNIGVINAGDGSGQHPSQCMLDMMTIHEHFGHFKGLKVAIVGDITNSRVAKSDM
ELLTRLGAEVYFSGPSYWYSKEFDKYGKYEELDKLIPDMDVMMLLRVQHERHAGDPNEKK
FDAKAYHEKYGINHKRYNELKPDTIIMHPGPINHDVELSGDLVESDKCMFVRQMQNGVFM
RMVMIEAVLRGRKLGGLE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttaaatcttgtcagtttaccacattttgttagtgttgaaaatttgcatgtt
gatgaagtagaggctttgatcaagcgagcagaatacttcaaaaaaggcggtgcaacgcct
cgcttaaccaagccggtatacgtgaccaacatgttctttgaagactcaagcagaacacat
acgagttttgaaatggctgaaagaaagttgggattaacagttatcccatttgatccagct
cactcatcagttaataaaggtgaaactttatacgacacttcactcatcatgaatgcctta
ggtgttgatcttgaagtgatccgccactcacaaaatgagtactacaacgatttgatcaac
ttaaaagatcaccaacacttaaacatcggtgtgatcaacgcaggtgatggtagtggtcaa
caccctagtcaatgtatgctcgacatgatgaccatccacgaacacttcggccacttcaaa
ggcttaaaagtagccatcgtcggcgacatcactaactcaagagtcgcaaaaagtgacatg
gaactgcttaccagattaggcgcagaagtctacttctcaggtccaagctactggtattca
aaggaatttgataaatacggtaagtatgaagaattagacaagttgatccctgacatggat
gtcatgatgctgcttagagtacaacatgaacgtcatgcaggtgatcctaatgaaaagaaa
tttgatgcaaaagcataccatgaaaaatatggcatcaaccacaaacgttacaatgaatta
aagccagatacaatcatcatgcacccaggtccaattaaccacgacgttgaacttagcggt
gacttggtcgaaagcgacaagtgtatgtttgtccgtcaaatgcaaaacggcgtcttcatg
agaatggtcatgattgaagcagtattacgcggaagaaagctcggaggtctcgaataa

DBGET integrated database retrieval system