KEGG   Lactobacillus acidophilus 30SC: LAC30SC_08020Help
Entry
LAC30SC_08020     CDS       T01436                                 

Definition
Sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LAC30SC_08020
Enzymes [BR:lai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LAC30SC_08020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1544731..1546173)
Genome map
AA seq 480 aa AA seqDB search
MPIKNKVMLITYPDSLGKNLQELSEVLENDLKGAVGGIHLLPFFPSTGDRGFAPTDYTTV
DPKFGNWSDVEKLGEKYYLMFDFMINHISRHSKYYEDFQKNKDKSSYADMFLSWDKFWPK
GRPTKEDVDLIYKRKDRAPYQEITFADGSKEKLWNTFGPEQIDLDVRKKVTQKFIKDTLV
SLIKHGADIIRLDAFAYAVKKLDTNDFFVEPEIWNLLKQVQDDIADEGATILPEIHEHYS
MPFKISKHGYFIYDFALPMVTLYSLYSGKSNRLAAWLKKCPMKQFTTLDTHDGIGVVDAR
DILSPEEIDYTSQELYKVGANVKKKYSSAEYHNLDIYQINTTFYSALGDDDKRYFMARLL
QVFAPGIPQVYYVGMLAGKNDIKLLEETKEGRNINRHYYSKAEVEQEIQRPVVASLLKLF
TFRNNEPAFDLNGSIDISTPNENEIRIVRINKEQNHKAELTANLQDLTYRVLVNGKQINF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaaaaataaagtaatgttgattacctatccagatagtttaggtaaaaacttg
caagaattaagcgaagtcttagaaaatgatttaaaaggtgcggttggcggcattcattta
ctgccattctttccttcaacgggtgatcgcggatttgcaccaactgattacacgacagtt
gatcctaaatttggtaattggtcagatgttgaaaagttgggcgaaaaatactacctgatg
tttgattttatgatcaatcatatttctaggcattctaagtattacgaagattttcaaaag
aataaggacaaaagttcatatgcagatatgttcttaagttgggataagttttggccaaaa
ggtcgtccaactaaagaagatgtggacctaatctataagcgtaaagatcgtgctccatat
caagagattacttttgcggatgggagcaaggagaaactttggaatacttttggtcctgag
caaatcgatttagatgtgcgcaaaaaggttacgcaaaagtttattaaggacacgttggtt
agcctaattaagcacggagcagatatcattcgtttggatgcttttgcttatgctgtgaaa
aaactagatactaatgacttctttgtagaaccagaaatctggaatttgcttaagcaggta
caagatgatattgctgatgaaggagcaacgattttgccagaaatccatgagcattattct
atgccgttcaagatttcaaaacatggctactttatctacgactttgctctaccaatggtt
actctgtattcgctttattcaggtaaatccaatcgtttggcagcttggctaaagaaatgt
ccaatgaagcaattcactaccttggatactcatgatggtattggcgtagttgatgcgcgt
gatattctttctccagaagagatcgattacaccagccaagaactttataaagttggtgct
aatgttaagaaaaagtattcaagtgctgaatatcataatttggatatttatcaaattaat
actactttttattcagctttgggcgatgacgataaaagatacttcatggcaagattattg
caggtctttgctcctgggattccgcaggtctactatgttgggatgttagctggcaagaat
gatattaagctccttgaagaaactaaagaggggagaaatattaatcgtcattattacagc
aaagctgaagttgaacaagaaattcagcgacctgttgttgcctctttgttgaaactcttt
acttttagaaacaatgaacctgcatttgacttaaatggttctattgatatctctacccct
aatgaaaatgaaatccgtattgttcgaatcaataaagaacaaaatcataaagcagaatta
actgctaacttacaagatttaacttaccgagttttggttaacggtaagcaaatcaacttt
taa

DBGET integrated database retrieval system